DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment snRNP-U1-C and usp103

DIOPT Version :9

Sequence 1:NP_650767.1 Gene:snRNP-U1-C / 42274 FlyBaseID:FBgn0261792 Length:145 Species:Drosophila melanogaster
Sequence 2:NP_595384.1 Gene:usp103 / 2541289 PomBaseID:SPBP35G2.09 Length:182 Species:Schizosaccharomyces pombe


Alignment Length:140 Identity:51/140 - (36%)
Similarity:66/140 - (47%) Gaps:25/140 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MPKYYCDYCDTYLTHDSPSVRKTHCTGRKHRDNVKFYYQKWMEEQAQHLID--ATTAAFKAGKIT 63
            ||:|.||||..:|||||.||||.|..||.|..||:.||.|..:|:||..::  |::...|.|   
pombe     1 MPRYLCDYCQVWLTHDSQSVRKAHNAGRAHIQNVQDYYTKVAQEEAQKQLEERASSGFLKKG--- 62

  Fly    64 NNPFAGGPGGAPPKPAGVSIPPP----NMGAPPRPG-MPGMPYMPPL-MNPMMGMRPPPIM---- 118
                    .|:...|...:.||.    |:|.||.|. :....||.|. ||.|......|:|    
pombe    63 --------NGSLDLPYAYAFPPKYNVFNLGCPPPPYIVSANTYMAPKGMNAMNAAAFVPMMPAVN 119

  Fly   119 --NPMAMMGP 126
              |.:|...|
pombe   120 LTNQVAFSAP 129

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
snRNP-U1-CNP_650767.1 zf-U1 1..38 CDD:368798 22/36 (61%)
usp103NP_595384.1 COG5136 1..182 CDD:227465 51/140 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 58 1.000 Domainoid score I3100
eggNOG 1 0.900 - - E1_COG5136
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 73 1.000 Inparanoid score I1908
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003605
OrthoInspector 1 1.000 - - oto101438
orthoMCL 1 0.900 - - OOG6_102948
Panther 1 1.100 - - LDO PTHR31148
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1268
SonicParanoid 1 1.000 - - X2482
TreeFam 1 0.960 - -
1110.850

Return to query results.
Submit another query.