DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment snRNP-U1-C and snrpc

DIOPT Version :9

Sequence 1:NP_650767.1 Gene:snRNP-U1-C / 42274 FlyBaseID:FBgn0261792 Length:145 Species:Drosophila melanogaster
Sequence 2:NP_775358.1 Gene:snrpc / 192330 ZFINID:ZDB-GENE-020419-26 Length:159 Species:Danio rerio


Alignment Length:161 Identity:95/161 - (59%)
Similarity:108/161 - (67%) Gaps:26/161 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MPKYYCDYCDTYLTHDSPSVRKTHCTGRKHRDNVKFYYQKWMEEQAQHLIDATTAAFKAGKITNN 65
            |||:|||||||||||||||||||||:||||::|||.|||||||||||.|||.|||||:.|||...
Zfish     1 MPKFYCDYCDTYLTHDSPSVRKTHCSGRKHKENVKDYYQKWMEEQAQSLIDKTTAAFQQGKIPPT 65

  Fly    66 PFAGGPGGAPPKPAGVSIPPPNMGAPPRPGMPGMPYM--PPLMNPMMGMRP-------------P 115
            ||.    |||| |.|..:|.|::|.||||||...|.|  ||:| ||||..|             |
Zfish    66 PFP----GAPP-PGGSLLPHPSIGGPPRPGMLPAPPMGGPPMM-PMMGPPPHAMMPGGPGPGMRP 124

  Fly   116 PIMNPMAMM-GP----PPPLGTIPGVRPGIM 141
            |:..||.|| ||    ||....:|.||||::
Zfish   125 PMGGPMQMMPGPHMMRPPARPMMPAVRPGMV 155

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
snRNP-U1-CNP_650767.1 zf-U1 1..38 CDD:368798 31/36 (86%)
snrpcNP_775358.1 zf-U1 1..38 CDD:114912 31/36 (86%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 61..99 21/42 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 96 1.000 Domainoid score I7308
eggNOG 1 0.900 - - E1_COG5136
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 175 1.000 Inparanoid score I4058
OMA 1 1.010 - - QHG53368
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003605
OrthoInspector 1 1.000 - - oto39378
orthoMCL 1 0.900 - - OOG6_102948
Panther 1 1.100 - - LDO PTHR31148
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1268
SonicParanoid 1 1.000 - - X2482
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1312.860

Return to query results.
Submit another query.