DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dnk and TK2

DIOPT Version :9

Sequence 1:NP_001262722.1 Gene:dnk / 42273 FlyBaseID:FBgn0022338 Length:250 Species:Drosophila melanogaster
Sequence 2:NP_004605.4 Gene:TK2 / 7084 HGNCID:11831 Length:265 Species:Homo sapiens


Alignment Length:214 Identity:97/214 - (45%)
Similarity:137/214 - (64%) Gaps:2/214 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 KYAEGTQPFTVLIEGNIGSGKTTYLNHFEKYKNDICLLTEPVEKWRNVNGVNLLELMYKDPKKWA 77
            |..|..:...:.:||||.|||||.|..|.. ..|:.:|||||.|||||.|.|.|.|||.|..:|.
Human    43 KEQEKEKKSVICVEGNIASGKTTCLEFFSN-ATDVEVLTEPVSKWRNVRGHNPLGLMYHDASRWG 106

  Fly    78 MPFQSYVTLTMLQSHTAPTNKKLKIMERSIFSARYCFVENMRRNGSLEQGMYNTLEEWYKFIEES 142
            :..|:||.||||..||.|....:::|||||.||||.||||:.|:|.:.:..|..|.||:.:|..:
Human   107 LTLQTYVQLTMLDRHTRPQVSSVRLMERSIHSARYIFVENLYRSGKMPEVDYVVLSEWFDWILRN 171

  Fly   143 IHVQADLIIYLRTSPEVAYERIRQRARSEESCVPLKYLQELHELHEDWLIH-QRRPQSCKVLVLD 206
            :.|..|||:||||:||..|:|:::|.|.||..:||:||:.:|.|||:|||. ...|.:..|||::
Human   172 MDVSVDLIVYLRTNPETCYQRLKKRCREEEKVIPLEYLEAIHHLHEEWLIKGSLFPMAAPVLVIE 236

  Fly   207 ADLNLENIGTEYQRSESSI 225
            ||.::|.:...::::...|
Human   237 ADHHMERMLELFEQNRDRI 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dnkNP_001262722.1 dNK 23..214 CDD:238836 94/191 (49%)
DTMP_kinase 23..214 CDD:161676 94/191 (49%)
TK2NP_004605.4 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 20..47 1/3 (33%)
dNK 53..265 CDD:279974 95/204 (47%)
DTMP_kinase 53..238 CDD:161676 91/185 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165145127
Domainoid 1 1.000 193 1.000 Domainoid score I3211
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H3392
Inparanoid 1 1.050 195 1.000 Inparanoid score I3836
Isobase 1 0.950 - 0 Normalized mean entropy S6389
OMA 1 1.010 - - QHG54257
OrthoDB 1 1.010 - - D1505356at2759
OrthoFinder 1 1.000 - - FOG0001503
OrthoInspector 1 1.000 - - oto90986
orthoMCL 1 0.900 - - OOG6_102194
Panther 1 1.100 - - LDO PTHR10513
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4541
SonicParanoid 1 1.000 - - X6020
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1615.850

Return to query results.
Submit another query.