DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dnk and Ndufa10

DIOPT Version :10

Sequence 1:NP_524399.1 Gene:dnk / 42273 FlyBaseID:FBgn0022338 Length:250 Species:Drosophila melanogaster
Sequence 2:NP_955789.2 Gene:Ndufa10 / 678759 RGDID:727968 Length:355 Species:Rattus norvegicus


Alignment Length:212 Identity:48/212 - (22%)
Similarity:89/212 - (41%) Gaps:44/212 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 VLIEGNIGSGKTTY---------LNHFE----KYKNDICLLTEPVEKWRNVNGVNLLELMYKDPK 74
            :.::|||.|||...         :.|:.    :|.:.......|::  ...:|...||..|.:||
  Rat    60 ITVDGNICSGKNKLARDIAEQLGMKHYPEAGIQYSSSTTGDGRPLD--IEFSGSCSLEKFYDNPK 122

  Fly    75 K---WAMPFQSYVTLT-MLQ-----SHTAPTNKKLKIMERSIFSARYCFVENMRRNGSLEQ---G 127
            .   .:...||::..: :||     .|...|.:.: ::||||:| .:.|:|.|...|.:.:   .
  Rat   123 SNDGNSYRLQSWLYASRLLQYSDALEHLLSTGQGV-VLERSIYS-DFVFLEAMYNQGFIRKQCVD 185

  Fly   128 MYN-----TLEEWYKFIEESIHVQADLIIYLRTSPEVAYERIRQRARSEESCVPLKYLQELHELH 187
            .||     ||.|         ::....:||:.........||:::....|..|...|||::.:.:
  Rat   186 HYNEIKRLTLPE---------YLPPHAVIYIDVPVSEIQSRIQKKGDPHEMKVTSAYLQDIEDAY 241

  Fly   188 EDWLIHQRRPQSCKVLV 204
            :...: .:..:.|:|||
  Rat   242 KKTFL-PKMSEICEVLV 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dnkNP_524399.1 dNK 23..214 CDD:238836 48/212 (23%)
Ndufa10NP_955789.2 NDUO42 59..277 CDD:238988 48/212 (23%)

Return to query results.
Submit another query.