DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dnk and Ndufa10

DIOPT Version :9

Sequence 1:NP_001262722.1 Gene:dnk / 42273 FlyBaseID:FBgn0022338 Length:250 Species:Drosophila melanogaster
Sequence 2:NP_955789.2 Gene:Ndufa10 / 678759 RGDID:727968 Length:355 Species:Rattus norvegicus


Alignment Length:212 Identity:48/212 - (22%)
Similarity:89/212 - (41%) Gaps:44/212 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 VLIEGNIGSGKTTY---------LNHFE----KYKNDICLLTEPVEKWRNVNGVNLLELMYKDPK 74
            :.::|||.|||...         :.|:.    :|.:.......|::  ...:|...||..|.:||
  Rat    60 ITVDGNICSGKNKLARDIAEQLGMKHYPEAGIQYSSSTTGDGRPLD--IEFSGSCSLEKFYDNPK 122

  Fly    75 K---WAMPFQSYVTLT-MLQ-----SHTAPTNKKLKIMERSIFSARYCFVENMRRNGSLEQ---G 127
            .   .:...||::..: :||     .|...|.:.: ::||||:| .:.|:|.|...|.:.:   .
  Rat   123 SNDGNSYRLQSWLYASRLLQYSDALEHLLSTGQGV-VLERSIYS-DFVFLEAMYNQGFIRKQCVD 185

  Fly   128 MYN-----TLEEWYKFIEESIHVQADLIIYLRTSPEVAYERIRQRARSEESCVPLKYLQELHELH 187
            .||     ||.|         ::....:||:.........||:::....|..|...|||::.:.:
  Rat   186 HYNEIKRLTLPE---------YLPPHAVIYIDVPVSEIQSRIQKKGDPHEMKVTSAYLQDIEDAY 241

  Fly   188 EDWLIHQRRPQSCKVLV 204
            :...: .:..:.|:|||
  Rat   242 KKTFL-PKMSEICEVLV 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dnkNP_001262722.1 dNK 23..214 CDD:238836 48/212 (23%)
DTMP_kinase 23..214 CDD:161676 48/212 (23%)
Ndufa10NP_955789.2 NDUO42 59..277 CDD:238988 48/212 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1428
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.