DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dnk and dck.1

DIOPT Version :9

Sequence 1:NP_001262722.1 Gene:dnk / 42273 FlyBaseID:FBgn0022338 Length:250 Species:Drosophila melanogaster
Sequence 2:NP_001025532.1 Gene:dck.1 / 594934 XenbaseID:XB-GENE-956567 Length:265 Species:Xenopus tropicalis


Alignment Length:231 Identity:73/231 - (31%)
Similarity:119/231 - (51%) Gaps:29/231 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 VLIEGNIGSGKTTYLNHFEKYKNDICLLTEPVEKWRNV---------------NGVNLLELMYKD 72
            :.|||||.:||:|::|..:|...|..::.||:.:|.|:               :|.|||::||:.
 Frog    26 ISIEGNIAAGKSTFVNILKKANEDWEVVPEPIARWCNIQSCKDEFEELTTSQKSGGNLLQMMYEK 90

  Fly    73 PKKWAMPFQSYVTLTMLQSHTAPTNKKLK-------IMERSIFSARYCFVENMRRNGSLEQGMYN 130
            |::|:..||||..|:.:::.......|||       ..|||::|.||.|..|:.....:.:..:.
 Frog    91 PERWSFTFQSYACLSRIRAQLKALGGKLKEAENPVLFFERSVYSDRYIFASNLYEAECMNETEWT 155

  Fly   131 TLEEWYKFIEESI--HVQADLIIYLRTSPEVAYERIRQRARSEESCVPLKYLQELHELHEDWLIH 193
            ..::|:.::....  .::.|.|||||..||....||..|.|.||..:|::||::||..||.||.|
 Frog   156 VYQDWHDWMNSQFGADLELDGIIYLRAIPEKCLNRIYSRGREEEQGIPMEYLEKLHYKHESWLHH 220

  Fly   194 QRRPQSCKVL----VLDADLNLENIGTEYQRSESSI 225
            :......:.|    :|..|:| |:.....|:.||.|
 Frog   221 RTMRTDFEYLQEIPILTLDVN-EDFKDNKQKQESLI 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dnkNP_001262722.1 dNK 23..214 CDD:238836 69/218 (32%)
DTMP_kinase 23..214 CDD:161676 69/218 (32%)
dck.1NP_001025532.1 dNK 26..263 CDD:366769 73/231 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1505356at2759
OrthoFinder 1 1.000 - - FOG0001503
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.