DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dnk and Tk2

DIOPT Version :9

Sequence 1:NP_001262722.1 Gene:dnk / 42273 FlyBaseID:FBgn0022338 Length:250 Species:Drosophila melanogaster
Sequence 2:NP_066356.3 Gene:Tk2 / 57813 MGIID:1913266 Length:270 Species:Mus musculus


Alignment Length:204 Identity:96/204 - (47%)
Similarity:136/204 - (66%) Gaps:2/204 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 VLIEGNIGSGKTTYLNHFEKYKNDICLLTEPVEKWRNVNGVNLLELMYKDPKKWAMPFQSYVTLT 87
            |.|||||.|||||.|..|.. ..|:.:|.|||.|||||:|.|.|.|||.|..:|.:..|:||.||
Mouse    58 VCIEGNIASGKTTCLEFFSN-TTDVEVLMEPVLKWRNVHGHNPLSLMYHDASRWGLTLQTYVQLT 121

  Fly    88 MLQSHTAPTNKKLKIMERSIFSARYCFVENMRRNGSLEQGMYNTLEEWYKFIEESIHVQADLIIY 152
            ||..||.|....:::|||||:||||.||||:.|:|.:.:..|..|.||:.:|..:|.|..|||:|
Mouse   122 MLDQHTRPQMSPVRLMERSIYSARYIFVENLYRSGKMPEVDYAILSEWFDWIVRNIDVSVDLIVY 186

  Fly   153 LRTSPEVAYERIRQRARSEESCVPLKYLQELHELHEDWLIH-QRRPQSCKVLVLDADLNLENIGT 216
            |||:||:.|:|::.|.|.||..:|::||..:|.|:|:||:: ...|.:..|||::||.|||.:..
Mouse   187 LRTTPEICYQRLKMRCREEEKVIPMEYLHAIHRLYEEWLVNGSLFPAAAPVLVIEADHNLEKMLE 251

  Fly   217 EYQRSESSI 225
            .::::.:.|
Mouse   252 LFEQNRARI 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dnkNP_001262722.1 dNK 23..214 CDD:238836 95/191 (50%)
DTMP_kinase 23..214 CDD:161676 95/191 (50%)
Tk2NP_066356.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..54
dNK 58..265 CDD:366769 96/204 (47%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167835232
Domainoid 1 1.000 194 1.000 Domainoid score I3174
eggNOG 1 0.900 - - E1_COG1428
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H3392
Inparanoid 1 1.050 196 1.000 Inparanoid score I3809
Isobase 1 0.950 - 0 Normalized mean entropy S6389
OMA 1 1.010 - - QHG54257
OrthoDB 1 1.010 - - D1505356at2759
OrthoFinder 1 1.000 - - FOG0001503
OrthoInspector 1 1.000 - - oto94570
orthoMCL 1 0.900 - - OOG6_102194
Panther 1 1.100 - - LDO PTHR10513
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4541
SonicParanoid 1 1.000 - - X6020
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1716.750

Return to query results.
Submit another query.