DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dnk and tk2

DIOPT Version :9

Sequence 1:NP_001262722.1 Gene:dnk / 42273 FlyBaseID:FBgn0022338 Length:250 Species:Drosophila melanogaster
Sequence 2:NP_001016888.1 Gene:tk2 / 549642 XenbaseID:XB-GENE-983640 Length:274 Species:Xenopus tropicalis


Alignment Length:223 Identity:99/223 - (44%)
Similarity:143/223 - (64%) Gaps:4/223 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 AASCARKGTKYAEGTQPFTVLIEGNIGSGKTTYLNHFEKYKNDICLLTEPVEKWRNVNGVNLLEL 68
            ::..|..|.|:.|  :...:.:||||.||||:.|:.|.. ..|:.:..|||.|||||.|.|.|.|
 Frog    52 SSGSAGNGLKHRE--KSTLICVEGNIASGKTSCLDFFSN-TADLEVYKEPVAKWRNVRGHNPLGL 113

  Fly    69 MYKDPKKWAMPFQSYVTLTMLQSHTAPTNKKLKIMERSIFSARYCFVENMRRNGSLEQGMYNTLE 133
            ||:||.||.:..|:||.||||..||.|:...:|:|||||:||:|.||||:.::|.:.:..|..|.
 Frog   114 MYQDPNKWGLTLQTYVQLTMLDIHTKPSISPVKMMERSIYSAKYIFVENLYQSGKMPEVDYAILT 178

  Fly   134 EWYKFIEESIHVQADLIIYLRTSPEVAYERIRQRARSEESCVPLKYLQELHELHEDWLIHQRR-P 197
            ||:::|.::.....|||:||:||||..|:|:::|.|.||..:||:||..:|.|:||||:.|.. |
 Frog   179 EWFEWIVKNTDTSVDLIVYLQTSPETCYQRLKKRCREEERVIPLEYLYAIHNLYEDWLVKQTSFP 243

  Fly   198 QSCKVLVLDADLNLENIGTEYQRSESSI 225
            ....|||:||:..||.:...|:.:..||
 Frog   244 VPAPVLVIDANKELEEMNRHYEENRGSI 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dnkNP_001262722.1 dNK 23..214 CDD:238836 92/191 (48%)
DTMP_kinase 23..214 CDD:161676 92/191 (48%)
tk2NP_001016888.1 DTMP_kinase 65..259 CDD:161676 91/194 (47%)
dNK 69..273 CDD:279974 95/204 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 188 1.000 Domainoid score I3272
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H3392
Inparanoid 1 1.050 200 1.000 Inparanoid score I3670
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1505356at2759
OrthoFinder 1 1.000 - - FOG0001503
OrthoInspector 1 1.000 - - oto104774
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4541
SonicParanoid 1 1.000 - - X6020
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
99.090

Return to query results.
Submit another query.