DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dnk and dck.2

DIOPT Version :9

Sequence 1:NP_001262722.1 Gene:dnk / 42273 FlyBaseID:FBgn0022338 Length:250 Species:Drosophila melanogaster
Sequence 2:NP_001016792.1 Gene:dck.2 / 549546 XenbaseID:XB-GENE-5727742 Length:264 Species:Xenopus tropicalis


Alignment Length:219 Identity:69/219 - (31%)
Similarity:114/219 - (52%) Gaps:30/219 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 IEGNIGSGKTTYLNHFEKYKNDICLLTEPVEKWRNV---------------NGVNLLELMYKDPK 74
            :||||.:||:|::...||..::..::.||:.||.||               :|.|||:::|..|.
 Frog    27 VEGNIAAGKSTFVRILEKANDEWEVVPEPIAKWCNVQTTGNEDEELSTSQKSGGNLLQMLYDKPT 91

  Fly    75 KWAMPFQSYVTLTMLQSHTAPTNKKLK-------IMERSIFSARYCFVENMRRNGSLEQGMYNTL 132
            :||..||:|..|:.:::...|.:.||:       ..|||::|.||.|..::..:.::.:..:...
 Frog    92 RWAYTFQTYACLSRVRAQLNPPSHKLREAEHPVQFFERSVYSDRYVFASSLFESQNINETEWAIY 156

  Fly   133 EEWYKFIEESIHVQADL--IIYLRTSPEVAYERIRQRARSEESCVPLKYLQELHELHEDWL---- 191
            ::|:.::........||  |||||.:||...:||..|.|.||..:.|:||:.||..||.||    
 Frog   157 QDWHTWLLNQFESDIDLDGIIYLRATPEKCMDRIHTRGRDEEQGIELEYLESLHYKHESWLYDRT 221

  Fly   192 --IHQRRPQSCKVLVLDADLNLEN 213
              :.....|...|||||.:.:.:|
 Frog   222 IQVDFENLQHMPVLVLDVNEDFKN 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dnkNP_001262722.1 dNK 23..214 CDD:238836 69/219 (32%)
DTMP_kinase 23..214 CDD:161676 69/219 (32%)
dck.2NP_001016792.1 dNK 25..261 CDD:366769 69/219 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1505356at2759
OrthoFinder 1 1.000 - - FOG0001503
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.