DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dnk and zgc:110540

DIOPT Version :9

Sequence 1:NP_001262722.1 Gene:dnk / 42273 FlyBaseID:FBgn0022338 Length:250 Species:Drosophila melanogaster
Sequence 2:NP_001014374.1 Gene:zgc:110540 / 541538 ZFINID:ZDB-GENE-050327-77 Length:264 Species:Danio rerio


Alignment Length:221 Identity:69/221 - (31%)
Similarity:118/221 - (53%) Gaps:30/221 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 VLIEGNIGSGKTTYLNHFEKYKNDICLLTEPVEKWRNV---------------NGVNLLELMYKD 72
            |.|||||.:||:|::...|:...:..::.||:.||.||               :|.|||:::|..
Zfish    25 VSIEGNIAAGKSTFVRLLERASEEWEVIPEPIGKWCNVQTTENGYEELSTSQKSGGNLLQMLYDK 89

  Fly    73 PKKWAMPFQSYVTLTMLQSHTAPTNKKL-------KIMERSIFSARYCFVENMRRNGSLEQGMYN 130
            |.:|:..||:|..|:.::|...|.:.||       :..|||::|.||.|..|:..:|.|.:..:.
Zfish    90 PSRWSYTFQTYACLSRVRSQLQPPSAKLQQAEKPVQFFERSVYSDRYVFASNLFESGDLNETEWA 154

  Fly   131 TLEEWYKFI--EESIHVQADLIIYLRTSPEVAYERIRQRARSEESCVPLKYLQELHELHEDWLIH 193
            ..::|:.::  :....::.|.:||||..||...:|::.|.|.||..:||.||::||..||.||.:
Zfish   155 IYQDWHSWLLTQFESQIELDAMIYLRADPERCMQRLQFRGREEEQGIPLDYLEKLHYKHECWLYN 219

  Fly   194 QRRP------QSCKVLVLDADLNLEN 213
            |...      :...:|:||.:.:.:|
Zfish   220 QTTKLDFEYLKDLPILILDVNEDFKN 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dnkNP_001262722.1 dNK 23..214 CDD:238836 69/221 (31%)
DTMP_kinase 23..214 CDD:161676 69/221 (31%)
zgc:110540NP_001014374.1 Tmk 20..261 CDD:223203 69/221 (31%)
dNK 25..262 CDD:279974 69/221 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1428
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54257
OrthoDB 1 1.010 - - D1505356at2759
OrthoFinder 1 1.000 - - FOG0001503
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_102194
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
65.730

Return to query results.
Submit another query.