DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dnk and dck

DIOPT Version :9

Sequence 1:NP_001262722.1 Gene:dnk / 42273 FlyBaseID:FBgn0022338 Length:250 Species:Drosophila melanogaster
Sequence 2:NP_001007057.1 Gene:dck / 474325 ZFINID:ZDB-GENE-041024-3 Length:263 Species:Danio rerio


Alignment Length:216 Identity:71/216 - (32%)
Similarity:117/216 - (54%) Gaps:28/216 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 VLIEGNIGSGKTTYLNHFEKYKNDICLLTEPVEKWRNV---------------NGVNLLELMYKD 72
            :.|||||.:||:|::...|::..:..::.||:.:|.||               :|.|:|::||:.
Zfish    24 ISIEGNIAAGKSTFVRLLEEHDREWEVVPEPIARWCNVQTQHDDHEELTTSQKSGGNVLQMMYEK 88

  Fly    73 PKKWAMPFQSYVTLTMLQSHTAPTNKKLK-------IMERSIFSARYCFVENMRRNGSLEQGMYN 130
            |::||..||||..::.::|....||.||:       ..|||::|.||.|..|:..:..:.:..:.
Zfish    89 PERWAYTFQSYACMSRIRSQIKSTNGKLREAENPVQFFERSVYSDRYIFASNLYESECVNETEWA 153

  Fly   131 TLEEWYKFIEESI--HVQADLIIYLRTSPEVAYERIRQRARSEESCVPLKYLQELHELHEDWLIH 193
            ..::|:.::.:..  |::.|.|||||..||...||:..|.|.||..:||:||::||..||.||.|
Zfish   154 IYQDWHSWLHKQFGKHIELDGIIYLRAKPERCLERLHLRGREEEQGIPLEYLEKLHYKHECWLQH 218

  Fly   194 QRRPQSCKVL----VLDADLN 210
            :........|    ||..|:|
Zfish   219 RTMSMDFDYLNDVPVLTLDVN 239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dnkNP_001262722.1 dNK 23..214 CDD:238836 71/216 (33%)
DTMP_kinase 23..214 CDD:161676 71/216 (33%)
dckNP_001007057.1 dNK 24..261 CDD:279974 71/216 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1428
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54257
OrthoDB 1 1.010 - - D1505356at2759
OrthoFinder 1 1.000 - - FOG0001503
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_102194
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
65.730

Return to query results.
Submit another query.