DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dnk and tk2

DIOPT Version :9

Sequence 1:NP_001262722.1 Gene:dnk / 42273 FlyBaseID:FBgn0022338 Length:250 Species:Drosophila melanogaster
Sequence 2:NP_001002743.2 Gene:tk2 / 437016 ZFINID:ZDB-GENE-040718-243 Length:268 Species:Danio rerio


Alignment Length:222 Identity:100/222 - (45%)
Similarity:149/222 - (67%) Gaps:7/222 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 KGTKYAEGTQPFTVLIEGNIGSGKTTYLNHFEKYKNDICLLTEPVEKWRNVNGVNLLELMYKDPK 74
            |..:..||.:. .:.:||||.|||||.|.:|.| .:||.:|||||.|||||.|.|.|.|||:||.
Zfish    50 KLVRNGEGKKS-VICLEGNIASGKTTCLEYFSK-TSDIEVLTEPVSKWRNVQGCNPLGLMYQDPT 112

  Fly    75 KWAMPFQSYVTLTMLQSHTAPTNKKLKIMERSIFSARYCFVENMRRNGSLEQGMYNTLEEWYKFI 139
            :|.:..|:||.||||..|.:|....:::|||||:||:|.||||:.::|.:.:..:..|.||:::|
Zfish   113 RWGLTLQTYVQLTMLDQHVSPMTAPIRMMERSIYSAKYIFVENLYKSGKMPEVDFAVLSEWFEWI 177

  Fly   140 EESIHVQADLIIYLRTSPEVAYERIRQRARSEESCVPLKYLQELHELHEDWLIHQRR---PQSCK 201
            .::|.:..|||:||:|||:..:||::||.|.||..:||:||:.:|.|:|||||||:.   |  ..
Zfish   178 IKNISLPVDLIVYLQTSPQTCHERLKQRCREEEKVIPLEYLESIHNLYEDWLIHQKSFHVP--AP 240

  Fly   202 VLVLDADLNLENIGTEYQRSESSIFDA 228
            |||:.||.:|:.:..:::.:...|..|
Zfish   241 VLVIPADHDLKKMLHQFEENREKILMA 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dnkNP_001262722.1 dNK 23..214 CDD:238836 95/193 (49%)
DTMP_kinase 23..214 CDD:161676 95/193 (49%)
tk2NP_001002743.2 dNK 62..265 CDD:279974 95/205 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170578442
Domainoid 1 1.000 199 1.000 Domainoid score I3014
eggNOG 1 0.900 - - E1_COG1428
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H3392
Inparanoid 1 1.050 202 1.000 Inparanoid score I3725
OMA 1 1.010 - - QHG54257
OrthoDB 1 1.010 - - D1505356at2759
OrthoFinder 1 1.000 - - FOG0001503
OrthoInspector 1 1.000 - - oto39645
orthoMCL 1 0.900 - - OOG6_102194
Panther 1 1.100 - - LDO PTHR10513
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4541
SonicParanoid 1 1.000 - - X6020
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
1615.840

Return to query results.
Submit another query.