DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dnk and ndufa10

DIOPT Version :9

Sequence 1:NP_001262722.1 Gene:dnk / 42273 FlyBaseID:FBgn0022338 Length:250 Species:Drosophila melanogaster
Sequence 2:NP_955872.1 Gene:ndufa10 / 321951 ZFINID:ZDB-GENE-030131-670 Length:355 Species:Danio rerio


Alignment Length:211 Identity:53/211 - (25%)
Similarity:89/211 - (42%) Gaps:36/211 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MAEAASCARKGTKYAEGTQPFTVLIEGNIGSGKTTYLNHFEKYKNDICLLTEP----VEKW---- 57
            |.|.||     :::.|.::  .:.|:||:.|||........: |..:..:.||    |:|.    
Zfish    45 MGERAS-----SRFKENSK--IISIDGNLASGKGVLAQELAE-KLGMLYMPEPDTHYVDKMTKEK 101

  Fly    58 ----RNVNGVNLLELMYKDPKKWAMPFQSY------VTLTMLQ-----SHTAPTNKKLKIMERSI 107
                :..||...||..|.:||  |....||      ..:.:||     .|...|.:.: |:|||.
Zfish   102 VPLDQAFNGNCSLEKFYLEPK--ASDGNSYRLQAWMYLMRLLQYSDAVEHLLTTGQGV-ILERSP 163

  Fly   108 FSARYCFVENMRRNGSLEQGMYNTLEEWYKFIEESIHVQADLIIYLRTSPEVAYERIRQRARSEE 172
            || ...|:|.|.:.|.:.:...|...| .|.|.....:...|:||:.:..|...::::...:...
Zfish   164 FS-DVVFLEAMFKEGYIRKQCVNHYNE-IKGISICEFLPPHLVIYVDSPAEEVQKKLKASGKPYL 226

  Fly   173 SCVPLKYLQELHELHE 188
            ..|||.||:.:...::
Zfish   227 QNVPLSYLKSIETAYK 242

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dnkNP_001262722.1 dNK 23..214 CDD:238836 48/189 (25%)
DTMP_kinase 23..214 CDD:161676 48/189 (25%)
ndufa10NP_955872.1 NDUO42 59..277 CDD:238988 48/190 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1428
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.