DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dnk and Tk2

DIOPT Version :9

Sequence 1:NP_001262722.1 Gene:dnk / 42273 FlyBaseID:FBgn0022338 Length:250 Species:Drosophila melanogaster
Sequence 2:NP_001099636.1 Gene:Tk2 / 291824 RGDID:1309279 Length:270 Species:Rattus norvegicus


Alignment Length:204 Identity:95/204 - (46%)
Similarity:136/204 - (66%) Gaps:2/204 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 VLIEGNIGSGKTTYLNHFEKYKNDICLLTEPVEKWRNVNGVNLLELMYKDPKKWAMPFQSYVTLT 87
            |.|||||.|||||.|..|.. ..|:.:|.|||.|||||:|.|.|.|||.:..:|.:..|:||.||
  Rat    58 VCIEGNIASGKTTCLEFFSN-TTDVEVLMEPVLKWRNVHGHNPLSLMYHNASRWGLTLQTYVQLT 121

  Fly    88 MLQSHTAPTNKKLKIMERSIFSARYCFVENMRRNGSLEQGMYNTLEEWYKFIEESIHVQADLIIY 152
            ||..||.|....:::|||||:||||.||||:.|:|.:.:..|..|.||:.:|.::|.|..|||:|
  Rat   122 MLDQHTRPQMSPVRLMERSIYSARYIFVENLYRSGKMPEVDYAILSEWFDWIIKNIDVSVDLIVY 186

  Fly   153 LRTSPEVAYERIRQRARSEESCVPLKYLQELHELHEDWLI-HQRRPQSCKVLVLDADLNLENIGT 216
            |||:||:.|:|::.|.|.||..:|::||..:|.|:|:||: ....|.:..|||::||.|||.:..
  Rat   187 LRTTPEICYQRLKMRCREEEKVIPVEYLSAIHHLYEEWLVTGSLFPAAAPVLVIEADHNLEKMLE 251

  Fly   217 EYQRSESSI 225
            .::::.:.|
  Rat   252 LFEQNRARI 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dnkNP_001262722.1 dNK 23..214 CDD:238836 94/191 (49%)
DTMP_kinase 23..214 CDD:161676 94/191 (49%)
Tk2NP_001099636.1 dNK 58..265 CDD:279974 95/204 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166338832
Domainoid 1 1.000 191 1.000 Domainoid score I3154
eggNOG 1 0.900 - - E1_COG1428
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H3392
Inparanoid 1 1.050 193 1.000 Inparanoid score I3768
OMA 1 1.010 - - QHG54257
OrthoDB 1 1.010 - - D1505356at2759
OrthoFinder 1 1.000 - - FOG0001503
OrthoInspector 1 1.000 - - oto98082
orthoMCL 1 0.900 - - OOG6_102194
Panther 1 1.100 - - LDO PTHR10513
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X6020
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1615.770

Return to query results.
Submit another query.