DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dnk and Dguok

DIOPT Version :9

Sequence 1:NP_001262722.1 Gene:dnk / 42273 FlyBaseID:FBgn0022338 Length:250 Species:Drosophila melanogaster
Sequence 2:NP_038792.2 Gene:Dguok / 27369 MGIID:1351602 Length:277 Species:Mus musculus


Alignment Length:218 Identity:75/218 - (34%)
Similarity:115/218 - (52%) Gaps:27/218 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 EGTQPFTVLIEGNIGSGKTTYLNHFEKYKNDICLLTEPVEKWRNVNGV------------NLLEL 68
            :|..|..:.|||||..||:|::....|...:..:.|||:.:|:|:...            ||||:
Mouse    34 DGGGPRRLCIEGNIAVGKSTFVKLLMKTHPEWQVATEPIAEWQNIQAAGAQKDGTSKRLGNLLEM 98

  Fly    69 MYKDPKKWAMPFQSYVTLTMLQSHTAP-------TNKKLKIMERSIFSARYCFVENMRRNGSLEQ 126
            ||::|.:|:..||:...::.|:....|       ..|.:::.|||::|.||.|.:|:..||||..
Mouse    99 MYQEPARWSYTFQTLSFMSRLKVQLEPIPGRLLQAEKSVRVFERSVYSDRYIFAKNLFENGSLSD 163

  Fly   127 GMYNTLEEWYKFIEESIHVQADL--IIYLRTSPEVAYERIRQRARSEESCVPLKYLQELHELHED 189
            ..::..::|:.|:.:....:..|  .|||:.||:|..||:.||.|.||..:.|.|||:||..|||
Mouse   164 IEWHIYQDWHSFLLQEFANRLLLHGFIYLQASPQVCMERLYQRDREEEKGIELAYLQQLHSQHED 228

  Fly   190 WLI------HQRRPQSCKVLVLD 206
            |.|      |....|...|||||
Mouse   229 WFINKTTKLHFEALQHVPVLVLD 251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dnkNP_001262722.1 dNK 23..214 CDD:238836 73/211 (35%)
DTMP_kinase 23..214 CDD:161676 73/211 (35%)
DguokNP_038792.2 dNK 41..275 CDD:279974 73/211 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1428
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54257
OrthoDB 1 1.010 - - D1505356at2759
OrthoFinder 1 1.000 - - FOG0001503
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_102194
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
76.730

Return to query results.
Submit another query.