DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dnk and DGUOK

DIOPT Version :9

Sequence 1:NP_001262722.1 Gene:dnk / 42273 FlyBaseID:FBgn0022338 Length:250 Species:Drosophila melanogaster
Sequence 2:NP_550438.1 Gene:DGUOK / 1716 HGNCID:2858 Length:277 Species:Homo sapiens


Alignment Length:233 Identity:78/233 - (33%)
Similarity:123/233 - (52%) Gaps:30/233 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 GTQPFTVLIEGNIGSGKTTYLNHFEKYKNDICLLTEPVEKWRNVNGV------------NLLELM 69
            |..|..:.|||||..||:|::....|...:..:.||||..|:|:...            |||::|
Human    35 GRGPRRLSIEGNIAVGKSTFVKLLTKTYPEWHVATEPVATWQNIQAAGTQKACTAQSLGNLLDMM 99

  Fly    70 YKDPKKWAMPFQSYVTLTMLQSHTAPTNKKL-------KIMERSIFSARYCFVENMRRNGSLEQG 127
            |::|.:|:..||::..|:.|:....|..:||       :|.|||::|.||.|.:|:..||||...
Human   100 YREPARWSYTFQTFSFLSRLKVQLEPFPEKLLQARKPVQIFERSVYSDRYIFAKNLFENGSLSDI 164

  Fly   128 MYNTLEEWYKFI--EESIHVQADLIIYLRTSPEVAYERIRQRARSEESCVPLKYLQELHELHEDW 190
            .::..::|:.|:  |.:..:.....|||:.||:|..:|:.||||.||..:.|.||::||..||.|
Human   165 EWHIYQDWHSFLLWEFASRITLHGFIYLQASPQVCLKRLYQRAREEEKGIELAYLEQLHGQHEAW 229

  Fly   191 LIHQRRP------QSCKVLVLDADLNLENIGTEYQRSE 222
            |||:...      .:..|||||.:   ::...|..:.|
Human   230 LIHKTTKLHFEALMNIPVLVLDVN---DDFSEEVTKQE 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dnkNP_001262722.1 dNK 23..214 CDD:238836 74/217 (34%)
DTMP_kinase 23..214 CDD:161676 74/217 (34%)
DGUOKNP_550438.1 dNK 41..275 CDD:279974 76/227 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1428
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54257
OrthoDB 1 1.010 - - D1505356at2759
OrthoFinder 1 1.000 - - FOG0001503
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_102194
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
76.730

Return to query results.
Submit another query.