DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dnk and DCK

DIOPT Version :9

Sequence 1:NP_001262722.1 Gene:dnk / 42273 FlyBaseID:FBgn0022338 Length:250 Species:Drosophila melanogaster
Sequence 2:NP_000779.1 Gene:DCK / 1633 HGNCID:2704 Length:260 Species:Homo sapiens


Alignment Length:247 Identity:76/247 - (30%)
Similarity:132/247 - (53%) Gaps:33/247 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 AEGTQPFTVLIEGNIGSGKTTYLNHFEKYKNDICLLTEPVEKWRNV---------------NGVN 64
            :|||:...:.|||||.:||:|::|..::...|..::.|||.:|.||               ||.|
Human    16 SEGTRIKKISIEGNIAAGKSTFVNILKQLCEDWEVVPEPVARWCNVQSTQDEFEELTMSQKNGGN 80

  Fly    65 LLELMYKDPKKWAMPFQSYVTLTMLQSHTAPTNKKLK-------IMERSIFSARYCFVENMRRNG 122
            :|::||:.|::|:..||:|..|:.:::..|..|.|||       ..|||::|.||.|..|:..:.
Human    81 VLQMMYEKPERWSFTFQTYACLSRIRAQLASLNGKLKDAEKPVLFFERSVYSDRYIFASNLYESE 145

  Fly   123 SLEQGMYNTLEEWYKFIEESI--HVQADLIIYLRTSPEVAYERIRQRARSEESCVPLKYLQELHE 185
            .:.:..:...::|:.::....  .::.|.||||:.:||....||..|.|:||..:||:||::||.
Human   146 CMNETEWTIYQDWHDWMNNQFGQSLELDGIIYLQATPETCLHRIYLRGRNEEQGIPLEYLEKLHY 210

  Fly   186 LHEDWLIHQRRP------QSCKVLVLDADLNLENIGTEYQRSESSIFDAISS 231
            .||.||:|:...      |...:|.||.:   |:...:|:.....:.:.:|:
Human   211 KHESWLLHRTLKTNFDYLQEVPILTLDVN---EDFKDKYESLVEKVKEFLST 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dnkNP_001262722.1 dNK 23..214 CDD:238836 71/220 (32%)
DTMP_kinase 23..214 CDD:161676 71/220 (32%)
DCKNP_000779.1 dNK 24..258 CDD:279974 72/236 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1428
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54257
OrthoDB 1 1.010 - - D1505356at2759
OrthoFinder 1 1.000 - - FOG0001503
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_102194
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
65.730

Return to query results.
Submit another query.