DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dnk and Dck

DIOPT Version :9

Sequence 1:NP_001262722.1 Gene:dnk / 42273 FlyBaseID:FBgn0022338 Length:250 Species:Drosophila melanogaster
Sequence 2:NP_031858.1 Gene:Dck / 13178 MGIID:102726 Length:260 Species:Mus musculus


Alignment Length:232 Identity:78/232 - (33%)
Similarity:126/232 - (54%) Gaps:29/232 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 CARKGTKYAEGTQPFTVLIEGNIGSGKTTYLNHFEKYKNDICLLTEPVEKWRNV----------- 60
            |....|. :|||:...:.|||||.:||:|::|..::...|..::.|||.:|.||           
Mouse     9 CPSPSTS-SEGTRIKKISIEGNIAAGKSTFVNILKQASEDWEVVPEPVARWCNVQSTQEEFEELT 72

  Fly    61 ----NGVNLLELMYKDPKKWAMPFQSYVTLTMLQSHTAPTNKKLK-------IMERSIFSARYCF 114
                :|.|:|::||:.|::|:..||||..|:.:::..|..|.|||       ..|||::|.||.|
Mouse    73 TSQKSGGNVLQMMYEKPERWSFTFQSYACLSRIRAQLASLNGKLKDAEKPVLFFERSVYSDRYIF 137

  Fly   115 VENMRRNGSLEQGMYNTLEEWYKFIEESI--HVQADLIIYLRTSPEVAYERIRQRARSEESCVPL 177
            ..|:..:..:.:..:...::|:.::....  .::.|.|||||.:||....||..|.|:||..:||
Mouse   138 ASNLYESDCMNETEWTIYQDWHDWMNSQFGQSLELDGIIYLRATPEKCLNRIYLRGRNEEQGIPL 202

  Fly   178 KYLQELHELHEDWLIHQRRPQSC----KVLVLDADLN 210
            :||::||..||.||:|:....|.    :|.||..|:|
Mouse   203 EYLEKLHYKHESWLLHRTLKTSFDYLQEVPVLTLDVN 239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dnkNP_001262722.1 dNK 23..214 CDD:238836 73/216 (34%)
DTMP_kinase 23..214 CDD:161676 73/216 (34%)
DckNP_031858.1 dNK 24..258 CDD:279974 73/216 (34%)
Tmk 24..257 CDD:223203 73/216 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1428
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54257
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001503
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_102194
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.720

Return to query results.
Submit another query.