DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment euc and dhs-6

DIOPT Version :10

Sequence 1:NP_001247188.1 Gene:euc / 42271 FlyBaseID:FBgn0038665 Length:112 Species:Drosophila melanogaster
Sequence 2:NP_001021972.1 Gene:dhs-6 / 3565470 WormBaseID:WBGene00000970 Length:418 Species:Caenorhabditis elegans


Alignment Length:115 Identity:26/115 - (22%)
Similarity:47/115 - (40%) Gaps:16/115 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 DEIIEKI---RNKLKESDPARRTVVNTFQFNFTDADGNLIKSMVFDFKALDIYEGSAT------S 59
            :|.|::|   ..:|..:|..::|.. .::|...|......:.:..|.|.   .||:.|      .
 Worm   303 EEEIKQIFTSAKRLLNADIVKKTGF-VYEFLLKDPTTKSERIITLDLKN---GEGALTDKKASGK 363

  Fly    60 VDAQVTISDEDFYLVGTKQKTFQEVLQQEKAKIDGDEEA---INKMLEKF 106
            .|.:.|::.|.|..:.|.:......|..:|.:|.||...   :..:|.||
 Worm   364 ADVKFTLAPEHFAPLFTGKLRPTTALMTKKLQISGDMPGAMKLESLLRKF 413

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eucNP_001247188.1 SCP2 12..95 CDD:460423 18/88 (20%)
dhs-6NP_001021972.1 PRK08278 9..275 CDD:181349
SCP2 318..411 CDD:460423 19/96 (20%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.