DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment euc and Scp2d1

DIOPT Version :10

Sequence 1:NP_001247188.1 Gene:euc / 42271 FlyBaseID:FBgn0038665 Length:112 Species:Drosophila melanogaster
Sequence 2:NP_001101255.1 Gene:Scp2d1 / 311491 RGDID:1308385 Length:156 Species:Rattus norvegicus


Alignment Length:58 Identity:13/58 - (22%)
Similarity:26/58 - (44%) Gaps:0/58 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   206 LFLLSDETKSRKLKTSLKDHQKDFKKSLAQREKEPFTGGIVTILIRDILIKETFIAFL 263
            :|.:....::|||...::.....|...|.|....|||..|:::|...:.::...|..:
  Rat    47 MFSMGCTVEARKLWGHVRRPWGIFIGFLCQFGIMPFTAFILSLLFNVLPVQAVVIIIM 104

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eucNP_001247188.1 SCP2 12..95 CDD:460423
Scp2d1NP_001101255.1 SCP2 48..151 CDD:460423 13/57 (23%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.