DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment euc and dhs-28

DIOPT Version :10

Sequence 1:NP_001247188.1 Gene:euc / 42271 FlyBaseID:FBgn0038665 Length:112 Species:Drosophila melanogaster
Sequence 2:NP_509146.1 Gene:dhs-28 / 180950 WormBaseID:WBGene00000991 Length:436 Species:Caenorhabditis elegans


Alignment Length:113 Identity:27/113 - (23%)
Similarity:52/113 - (46%) Gaps:9/113 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKSDEIIEKIRNKLKESDPARRTVVNTFQFNFTDADGNLIKSMVFDFKAL--DIYEG---SATSV 60
            ::|..:.:::.:.:|....|.:|:.:...:..||....|.| ...|||:.  .:|.|   :....
 Worm   319 IRSSALFQEMADGVKADPTAVKTLKSIVLYIITDGKNELGK-FTLDFKSASPSVYLGDVKNGEKA 382

  Fly    61 DAQVTISDEDFYLVGTKQKTFQEVLQQEKAKIDGDEEAINKM---LEK 105
            :|.||::|.||..:...:...|:.....|.|:.|:...:.|:   |||
 Worm   383 NATVTVADSDFVDIAAGKLNAQKAFMSGKLKVKGNVMLLQKLQTVLEK 430

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eucNP_001247188.1 SCP2 12..95 CDD:460423 21/87 (24%)
dhs-28NP_509146.1 hydroxyacyl-CoA-like_DH_SDR_c-like 3..252 CDD:187611
SCP2 325..429 CDD:460423 23/104 (22%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.