DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment euc and SCP2D1

DIOPT Version :10

Sequence 1:NP_001247188.1 Gene:euc / 42271 FlyBaseID:FBgn0038665 Length:112 Species:Drosophila melanogaster
Sequence 2:NP_848578.1 Gene:SCP2D1 / 140856 HGNCID:16211 Length:156 Species:Homo sapiens


Alignment Length:97 Identity:25/97 - (25%)
Similarity:39/97 - (40%) Gaps:5/97 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 KSDEIIEKIRNKLKESDPARRTVVN-TFQFNFTDADGNLIKSMVFDFK--ALDIYEGSA-TSVDA 62
            :|..:.:.||..::|........|| .||.:.| .:|..|.....|.|  :.|:|.|.| ...|.
Human    43 ESFPVFQDIRLHIREVGAQLVKKVNAVFQLDIT-KNGKTILRWTIDLKNGSGDMYPGPARLPADT 106

  Fly    63 QVTISDEDFYLVGTKQKTFQEVLQQEKAKIDG 94
            ..||.:..|..:...:...|:.....|.|:.|
Human   107 VFTIPESVFMELVLGKMNPQKAFLAGKFKVSG 138

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eucNP_001247188.1 SCP2 12..95 CDD:460423 22/87 (25%)
SCP2D1NP_848578.1 SCP2 57..151 CDD:460423 22/83 (27%)

Return to query results.
Submit another query.