DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mpc1 and MPC2

DIOPT Version :10

Sequence 1:NP_650762.1 Gene:Mpc1 / 42268 FlyBaseID:FBgn0038662 Length:107 Species:Drosophila melanogaster
Sequence 2:NP_012032.1 Gene:MPC2 / 856567 SGDID:S000001205 Length:129 Species:Saccharomyces cerevisiae


Alignment Length:86 Identity:27/86 - (31%)
Similarity:46/86 - (53%) Gaps:12/86 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 MSTTASK-EWRDYFMS------THFWGPVANWGIPVAALADTQKSPKFISGKMTLALTLYSCIFM 64
            |||::.: .:|.::.|      .|||.|...||:..|..:|.::..:.|||...|:|...:.|:.
Yeast     1 MSTSSVRFAFRRFWQSETGPKTVHFWAPTLKWGLVFAGFSDMKRPVEKISGAQNLSLLSTALIWT 65

  Fly    65 RFAYKVQPRNWLL-----FAC 80
            |:::.::|||.||     |.|
Yeast    66 RWSFVIKPRNILLASVNSFLC 86

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mpc1NP_650762.1 MPC 21..107 CDD:427425 23/71 (32%)
MPC2NP_012032.1 MPC 9..118 CDD:427425 24/78 (31%)

Return to query results.
Submit another query.