DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mpc1 and AT5G20090

DIOPT Version :9

Sequence 1:NP_001262720.1 Gene:Mpc1 / 42268 FlyBaseID:FBgn0038662 Length:107 Species:Drosophila melanogaster
Sequence 2:NP_001078606.1 Gene:AT5G20090 / 832131 AraportID:AT5G20090 Length:110 Species:Arabidopsis thaliana


Alignment Length:89 Identity:47/89 - (52%)
Similarity:60/89 - (67%) Gaps:3/89 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 STHFWGPVANWGIPVAALADTQKSPKFISGKMTLALTLYSCIFMRFAYKVQPRNWLLFACHATNA 85
            :||||||:||||...|.|.|.||.|:.|||.|:.|:.:||.:|||||:.|||||:||.||||:|.
plant    18 TTHFWGPIANWGFVAAGLVDMQKPPEMISGNMSSAMCVYSALFMRFAWMVQPRNYLLLACHASNE 82

  Fly    86 TAQSIQGLRFLH---YNYGSKEQQ 106
            |.|..|..|:..   |....||::
plant    83 TVQLYQLSRWARAQGYLSSKKEEE 106

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mpc1NP_001262720.1 MPC 12..107 CDD:397629 47/89 (53%)
AT5G20090NP_001078606.1 MPC 6..107 CDD:397629 47/89 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 99 1.000 Domainoid score I2396
eggNOG 1 0.900 - - E1_KOG1590
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H9384
Inparanoid 1 1.050 100 1.000 Inparanoid score I2184
OMA 1 1.010 - - QHG53490
OrthoDB 1 1.010 - - D1584711at2759
OrthoFinder 1 1.000 - - FOG0004421
OrthoInspector 1 1.000 - - oto3526
orthoMCL 1 0.900 - - OOG6_102458
Panther 1 1.100 - - LDO PTHR14154
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X3135
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1514.840

Return to query results.
Submit another query.