DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mpc1 and Mpc1

DIOPT Version :10

Sequence 1:NP_650762.1 Gene:Mpc1 / 42268 FlyBaseID:FBgn0038662 Length:107 Species:Drosophila melanogaster
Sequence 2:NP_001351848.1 Gene:Mpc1 / 55951 MGIID:1915240 Length:167 Species:Mus musculus


Alignment Length:83 Identity:56/83 - (67%)
Similarity:65/83 - (78%) Gaps:0/83 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 STHFWGPVANWGIPVAALADTQKSPKFISGKMTLALTLYSCIFMRFAYKVQPRNWLLFACHATNA 85
            ||||||||||||:|:||:.|.:|||:.|||:||.||..||..|||||||||||||||||||.||.
Mouse    82 STHFWGPVANWGLPIAAINDMKKSPEIISGRMTFALCCYSLTFMRFAYKVQPRNWLLFACHVTNE 146

  Fly    86 TAQSIQGLRFLHYNYGSK 103
            .||.|||.|.::|....:
Mouse   147 VAQLIQGGRLINYEMSKR 164

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mpc1NP_650762.1 MPC 21..107 CDD:427425 56/83 (67%)
Mpc1NP_001351848.1 MPC 82..163 CDD:427425 56/80 (70%)

Return to query results.
Submit another query.