DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mpc1 and Mpc1l

DIOPT Version :9

Sequence 1:NP_001262720.1 Gene:Mpc1 / 42268 FlyBaseID:FBgn0038662 Length:107 Species:Drosophila melanogaster
Sequence 2:NP_001102835.1 Gene:Mpc1l / 503429 RGDID:1563528 Length:119 Species:Rattus norvegicus


Alignment Length:99 Identity:59/99 - (59%)
Similarity:72/99 - (72%) Gaps:0/99 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 IRRAMSTTASKEWRDYFMSTHFWGPVANWGIPVAALADTQKSPKFISGKMTLALTLYSCIFMRFA 67
            :|:......:||:|||..||||||||||||:|:||..|.:..|..|||:||.||..||..|||||
  Rat     8 MRKTRDYIKTKEFRDYITSTHFWGPVANWGLPLAAFKDMKAPPDIISGRMTTALIFYSMAFMRFA 72

  Fly    68 YKVQPRNWLLFACHATNATAQSIQGLRFLHYNYG 101
            |:|||||:||.|||.||..|||||..|:|::.||
  Rat    73 YRVQPRNYLLMACHFTNVLAQSIQASRYLNHRYG 106

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mpc1NP_001262720.1 MPC 12..107 CDD:397629 58/90 (64%)
Mpc1lNP_001102835.1 MPC 26..115 CDD:397629 53/81 (65%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1584711at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.