DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mpc1 and mpc1

DIOPT Version :9

Sequence 1:NP_001262720.1 Gene:Mpc1 / 42268 FlyBaseID:FBgn0038662 Length:107 Species:Drosophila melanogaster
Sequence 2:NP_001002398.2 Gene:mpc1 / 436671 ZFINID:ZDB-GENE-040718-94 Length:109 Species:Danio rerio


Alignment Length:100 Identity:68/100 - (68%)
Similarity:80/100 - (80%) Gaps:0/100 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 RRAMSTTASKEWRDYFMSTHFWGPVANWGIPVAALADTQKSPKFISGKMTLALTLYSCIFMRFAY 68
            |:|:....|||:|||.|||||||||||||:|:||::|.:|||:.|||:||.|||.||.:||||||
Zfish     7 RKAVDHLRSKEFRDYLMSTHFWGPVANWGLPIAAISDMKKSPEIISGRMTFALTCYSLLFMRFAY 71

  Fly    69 KVQPRNWLLFACHATNATAQSIQGLRFLHYNYGSK 103
            |||||||||||||.||..||.|||.|.:.||...|
Zfish    72 KVQPRNWLLFACHFTNEGAQLIQGSRLIKYNMEKK 106

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mpc1NP_001262720.1 MPC 12..107 CDD:397629 65/91 (71%)
mpc1NP_001002398.2 MPC 24..106 CDD:281629 58/81 (72%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170581983
Domainoid 1 1.000 147 1.000 Domainoid score I4473
eggNOG 1 0.900 - - E1_KOG1590
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H9384
Inparanoid 1 1.050 150 1.000 Inparanoid score I4346
OMA 1 1.010 - - QHG53490
OrthoDB 1 1.010 - - D1584711at2759
OrthoFinder 1 1.000 - - FOG0004421
OrthoInspector 1 1.000 - - oto41738
orthoMCL 1 0.900 - - OOG6_102458
Panther 1 1.100 - - LDO PTHR14154
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R737
SonicParanoid 1 1.000 - - X3135
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1615.800

Return to query results.
Submit another query.