DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mpc1 and CG9399

DIOPT Version :9

Sequence 1:NP_001262720.1 Gene:Mpc1 / 42268 FlyBaseID:FBgn0038662 Length:107 Species:Drosophila melanogaster
Sequence 2:NP_001163571.1 Gene:CG9399 / 41157 FlyBaseID:FBgn0037715 Length:154 Species:Drosophila melanogaster


Alignment Length:87 Identity:28/87 - (32%)
Similarity:41/87 - (47%) Gaps:4/87 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 FWGPVANWGIPVAALADTQKSPKFISGKMTLALTLYSCIFMRFAYKVQPRNWLLFACHATNATAQ 88
            ||.||..||:..|.|:|..:....||.....||.....|:.|::..:.|:|:.|||.:......|
  Fly    62 FWAPVFKWGLVAAGLSDLARPADTISVSGCAALAATGIIWSRYSLVIIPKNYSLFAVNLFVGITQ 126

  Fly    89 SIQGLRFLHYNYG----SKEQQ 106
            .:|..|..||:..    .:|||
  Fly   127 VVQLARAYHYHQSQEKLKQEQQ 148

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mpc1NP_001262720.1 MPC 12..107 CDD:397629 28/87 (32%)
CG9399NP_001163571.1 MPC 46..139 CDD:281629 25/76 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442593
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.