DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mpc1 and mpc2b

DIOPT Version :10

Sequence 1:NP_650762.1 Gene:Mpc1 / 42268 FlyBaseID:FBgn0038662 Length:107 Species:Drosophila melanogaster
Sequence 2:NP_997757.1 Gene:mpc2b / 321611 ZFINID:ZDB-GENE-030131-330 Length:127 Species:Danio rerio


Alignment Length:84 Identity:26/84 - (30%)
Similarity:43/84 - (51%) Gaps:3/84 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 FWGPVANWGIPVAALADTQKSPKFISGKMTLALTLYSCIFMRFAYKVQPRNWLLFACHATNATAQ 88
            ||.|:..||:.:|.|||..:..:.:|...:..||....|:.|::..:.|:||.|||.:....:..
Zfish    40 FWAPMFKWGLVLAGLADMARPAEKLSTSQSAVLTATGLIWSRYSLVIIPKNWNLFAVNFFVGSPG 104

  Fly    89 SIQGLRFLHYNYGSKEQQA 107
            ..|..|...:|   :||:|
Zfish   105 GSQLYRIWMHN---REQKA 120

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mpc1NP_650762.1 MPC 21..107 CDD:427425 25/82 (30%)
mpc2bNP_997757.1 MPC 24..126 CDD:427425 26/84 (31%)

Return to query results.
Submit another query.