DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mpc1 and CG32832

DIOPT Version :9

Sequence 1:NP_001262720.1 Gene:Mpc1 / 42268 FlyBaseID:FBgn0038662 Length:107 Species:Drosophila melanogaster
Sequence 2:NP_001285999.1 Gene:CG32832 / 318237 FlyBaseID:FBgn0052832 Length:140 Species:Drosophila melanogaster


Alignment Length:85 Identity:25/85 - (29%)
Similarity:40/85 - (47%) Gaps:5/85 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 FWGPVANWGIPVAALADT-QKSPKFISGKMTLALTLYSCIFMRFAYKVQPRNWLLFACHATNATA 87
            ||.|...|.:.:|.|:|| .:.|..||.....:|.:...|:.|::..:.|:|:.|.   |.|...
  Fly    42 FWAPAFKWSLVLAGLSDTLSRPPANISLNQCGSLAVTGLIWSRYSVVITPKNYNLL---AVNIAV 103

  Fly    88 QSIQG-LRFLHYNYGSKEQQ 106
            ..||| |...|..:.|:..:
  Fly   104 FLIQGYLMVKHLRWRSENSR 123

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mpc1NP_001262720.1 MPC 12..107 CDD:397629 25/85 (29%)
CG32832NP_001285999.1 MPC 26..123 CDD:281629 25/83 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442595
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.