DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mpc1 and mpc-1

DIOPT Version :9

Sequence 1:NP_001262720.1 Gene:Mpc1 / 42268 FlyBaseID:FBgn0038662 Length:107 Species:Drosophila melanogaster
Sequence 2:NP_497894.2 Gene:mpc-1 / 259500 WormBaseID:WBGene00011119 Length:137 Species:Caenorhabditis elegans


Alignment Length:90 Identity:56/90 - (62%)
Similarity:71/90 - (78%) Gaps:0/90 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 ASKEWRDYFMSTHFWGPVANWGIPVAALADTQKSPKFISGKMTLALTLYSCIFMRFAYKVQPRNW 75
            ::.||:.||:||||||||||||:|:|||.|.:|:|..|||.||.||.:||.:|||||:.|||||.
 Worm    16 STAEWKHYFLSTHFWGPVANWGLPLAALGDLKKNPDMISGPMTSALLIYSSVFMRFAWHVQPRNL 80

  Fly    76 LLFACHATNATAQSIQGLRFLHYNY 100
            ||||||..|.:||..|..||:::||
 Worm    81 LLFACHFANFSAQGAQLGRFVNHNY 105

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mpc1NP_001262720.1 MPC 12..107 CDD:397629 56/89 (63%)
mpc-1NP_497894.2 MPC 11..112 CDD:281629 56/90 (62%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 127 1.000 Domainoid score I3348
eggNOG 1 0.900 - - E1_KOG1590
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H9384
Inparanoid 1 1.050 127 1.000 Inparanoid score I3261
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53490
OrthoDB 1 1.010 - - D1584711at2759
OrthoFinder 1 1.000 - - FOG0004421
OrthoInspector 1 1.000 - - oto20133
orthoMCL 1 0.900 - - OOG6_102458
Panther 1 1.100 - - LDO PTHR14154
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R737
SonicParanoid 1 1.000 - - X3135
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1413.910

Return to query results.
Submit another query.