DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mpc1 and mpc2

DIOPT Version :10

Sequence 1:NP_650762.1 Gene:Mpc1 / 42268 FlyBaseID:FBgn0038662 Length:107 Species:Drosophila melanogaster
Sequence 2:NP_592846.1 Gene:mpc2 / 2541475 PomBaseID:SPAC24B11.09 Length:118 Species:Schizosaccharomyces pombe


Alignment Length:83 Identity:22/83 - (26%)
Similarity:41/83 - (49%) Gaps:0/83 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 STHFWGPVANWGIPVAALADTQKSPKFISGKMTLALTLYSCIFMRFAYKVQPRNWLLFACHATNA 85
            :.|||.|...|.:.::.:.|..:||:::|.:...||.....|:.|::..|:|:|:.....:...|
pombe    18 TVHFWAPAMKWTLVLSGIGDYARSPEYLSIRQYAALCATGAIWTRWSLIVRPKNYFNATVNFFLA 82

  Fly    86 TAQSIQGLRFLHYNYGSK 103
            ...::|..|.|.|....|
pombe    83 IVGAVQVSRILVYQRQQK 100

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mpc1NP_650762.1 MPC 21..107 CDD:427425 22/83 (27%)
mpc2NP_592846.1 MPC 5..105 CDD:427425 22/83 (27%)

Return to query results.
Submit another query.