DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mpc1 and mpc1

DIOPT Version :10

Sequence 1:NP_650762.1 Gene:Mpc1 / 42268 FlyBaseID:FBgn0038662 Length:107 Species:Drosophila melanogaster
Sequence 2:NP_587737.1 Gene:mpc1 / 2539169 PomBaseID:SPCC1235.11 Length:141 Species:Schizosaccharomyces pombe


Alignment Length:100 Identity:53/100 - (53%)
Similarity:75/100 - (75%) Gaps:0/100 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 RRAMSTTASKEWRDYFMSTHFWGPVANWGIPVAALADTQKSPKFISGKMTLALTLYSCIFMRFAY 68
            ||.::...|.::|.|..|||||||::|:|||:||:.|.:|.|:.|||:||.||.|||.:|||:|:
pombe    17 RRFITWLKSPDFRKYLCSTHFWGPLSNFGIPIAAILDLKKDPRLISGRMTGALILYSSVFMRYAW 81

  Fly    69 KVQPRNWLLFACHATNATAQSIQGLRFLHYNYGSK 103
            .|.|||:||..|||.|.|.|:.||:||:::.||.:
pombe    82 MVSPRNYLLLGCHAFNTTVQTAQGIRFVNFWYGKE 116

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mpc1NP_650762.1 MPC 21..107 CDD:427425 48/82 (59%)
mpc1NP_587737.1 MPC 28..131 CDD:427425 50/88 (57%)

Return to query results.
Submit another query.