DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mpc1 and SPCC1235.11

DIOPT Version :9

Sequence 1:NP_001262720.1 Gene:Mpc1 / 42268 FlyBaseID:FBgn0038662 Length:107 Species:Drosophila melanogaster
Sequence 2:NP_587737.1 Gene:SPCC1235.11 / 2539169 PomBaseID:SPCC1235.11 Length:141 Species:Schizosaccharomyces pombe


Alignment Length:100 Identity:53/100 - (53%)
Similarity:75/100 - (75%) Gaps:0/100 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 RRAMSTTASKEWRDYFMSTHFWGPVANWGIPVAALADTQKSPKFISGKMTLALTLYSCIFMRFAY 68
            ||.::...|.::|.|..|||||||::|:|||:||:.|.:|.|:.|||:||.||.|||.:|||:|:
pombe    17 RRFITWLKSPDFRKYLCSTHFWGPLSNFGIPIAAILDLKKDPRLISGRMTGALILYSSVFMRYAW 81

  Fly    69 KVQPRNWLLFACHATNATAQSIQGLRFLHYNYGSK 103
            .|.|||:||..|||.|.|.|:.||:||:::.||.:
pombe    82 MVSPRNYLLLGCHAFNTTVQTAQGIRFVNFWYGKE 116

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mpc1NP_001262720.1 MPC 12..107 CDD:397629 51/91 (56%)
SPCC1235.11NP_587737.1 MPC 28..131 CDD:281629 50/88 (57%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 115 1.000 Domainoid score I1531
eggNOG 1 0.900 - - E1_KOG1590
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H9384
Inparanoid 1 1.050 121 1.000 Inparanoid score I1492
OMA 1 1.010 - - QHG53490
OrthoFinder 1 1.000 - - FOG0004421
OrthoInspector 1 1.000 - - oto102079
orthoMCL 1 0.900 - - OOG6_102458
Panther 1 1.100 - - LDO PTHR14154
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R737
SonicParanoid 1 1.000 - - X3135
TreeFam 1 0.960 - -
1413.860

Return to query results.
Submit another query.