DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mpc1 and Mpc1

DIOPT Version :10

Sequence 1:NP_650762.1 Gene:Mpc1 / 42268 FlyBaseID:FBgn0038662 Length:107 Species:Drosophila melanogaster
Sequence 2:NP_598245.1 Gene:Mpc1 / 171087 RGDID:620902 Length:109 Species:Rattus norvegicus


Alignment Length:101 Identity:64/101 - (63%)
Similarity:77/101 - (76%) Gaps:0/101 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 IRRAMSTTASKEWRDYFMSTHFWGPVANWGIPVAALADTQKSPKFISGKMTLALTLYSCIFMRFA 67
            :|:|.....||::|||.|||||||||||||:|:||:.|.:|||:.|||:||.||..||..|||||
  Rat     6 VRKAADYVRSKDFRDYLMSTHFWGPVANWGLPIAAINDMKKSPEIISGRMTFALCCYSLTFMRFA 70

  Fly    68 YKVQPRNWLLFACHATNATAQSIQGLRFLHYNYGSK 103
            ||||||||||||||.||..||.|||.|.::|....:
  Rat    71 YKVQPRNWLLFACHVTNEVAQLIQGGRLINYEMSKR 106

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mpc1NP_650762.1 MPC 21..107 CDD:427425 56/83 (67%)
Mpc1NP_598245.1 MPC 24..105 CDD:427425 56/80 (70%)

Return to query results.
Submit another query.