DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mpc1 and Mpc1

DIOPT Version :9

Sequence 1:NP_001262720.1 Gene:Mpc1 / 42268 FlyBaseID:FBgn0038662 Length:107 Species:Drosophila melanogaster
Sequence 2:NP_598245.1 Gene:Mpc1 / 171087 RGDID:620902 Length:109 Species:Rattus norvegicus


Alignment Length:101 Identity:64/101 - (63%)
Similarity:77/101 - (76%) Gaps:0/101 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 IRRAMSTTASKEWRDYFMSTHFWGPVANWGIPVAALADTQKSPKFISGKMTLALTLYSCIFMRFA 67
            :|:|.....||::|||.|||||||||||||:|:||:.|.:|||:.|||:||.||..||..|||||
  Rat     6 VRKAADYVRSKDFRDYLMSTHFWGPVANWGLPIAAINDMKKSPEIISGRMTFALCCYSLTFMRFA 70

  Fly    68 YKVQPRNWLLFACHATNATAQSIQGLRFLHYNYGSK 103
            ||||||||||||||.||..||.|||.|.::|....:
  Rat    71 YKVQPRNWLLFACHVTNEVAQLIQGGRLINYEMSKR 106

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mpc1NP_001262720.1 MPC 12..107 CDD:397629 62/92 (67%)
Mpc1NP_598245.1 MPC 24..105 CDD:367595 56/80 (70%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166341937
Domainoid 1 1.000 131 1.000 Domainoid score I5048
eggNOG 1 0.900 - - E1_KOG1590
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H9384
Inparanoid 1 1.050 144 1.000 Inparanoid score I4357
OMA 1 1.010 - - QHG53490
OrthoDB 1 1.010 - - D1584711at2759
OrthoFinder 1 1.000 - - FOG0004421
OrthoInspector 1 1.000 - - oto98715
orthoMCL 1 0.900 - - OOG6_102458
Panther 1 1.100 - - LDO PTHR14154
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X3135
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1514.810

Return to query results.
Submit another query.