DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sgsh and Sgsh

DIOPT Version :9

Sequence 1:NP_650760.1 Gene:Sgsh / 42266 FlyBaseID:FBgn0038660 Length:524 Species:Drosophila melanogaster
Sequence 2:XP_038943465.1 Gene:Sgsh / 688293 RGDID:1591134 Length:502 Species:Rattus norvegicus


Alignment Length:503 Identity:267/503 - (53%)
Similarity:337/503 - (66%) Gaps:20/503 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 LWLIAGC-SAGPQNVLLLLADDAGFESGAYLNKFCQTPNLDALAKRGLLFNNAFTSVSSCSPSRS 73
            |.|:.|. .|..:||||::|||.|||||.|.|....||:|||||:..|:|.|||||||||||||:
  Rat    11 LLLVLGLYGAHSRNVLLIVADDGGFESGVYNNTAINTPHLDALARHSLIFRNAFTSVSSCSPSRA 75

  Fly    74 QLLTGQAGHSSGMYGLHQGVHNFNVLPDTGSLPNLIRDQSGGRILSGIIGKKHVGAANNFRFDFE 138
            .||||...|.:|||||||.||:||......||| |:..|:|.|  :|||||||||....:.|||.
  Rat    76 SLLTGLPQHQNGMYGLHQDVHHFNSFDKVQSLP-LLLSQAGVR--TGIIGKKHVGPETVYPFDFA 137

  Fly   139 QTEEQHSINQIGRNITRMKEYARQFLKQAKDEKKPFFLMVGFHDPHRCGHITPQFGEFCERWGSG 203
            .|||..|:.|:||||||:|:..|:|| |.:|: :||||.|..||||||||..||:|.|||::|:|
  Rat   138 FTEENSSVLQVGRNITRIKQLVRKFL-QTQDD-RPFFLYVALHDPHRCGHSQPQYGAFCEKFGNG 200

  Fly   204 EEGMGSIPDWKPIYYDWRNLDVPAWLPDTDVVRQELAAQYMTISRLDQGVGLMLKELEAAGVADQ 268
            |.|||.||||.|..||.:::.||.::|||...|.:|||||.||.|:|||:||:|:||..|||.:.
  Rat   201 ESGMGRIPDWTPQIYDPQDVMVPYFVPDTPAARADLAAQYTTIGRMDQGIGLVLQELRGAGVLND 265

  Fly   269 TLVIYTSDNGPPFPGGRTNLYEHGIRSPLIISSPNKEDRHHEATAAMVSLLDIYPSVMDALQIPR 333
            ||:|:|||||.|||.||||||..|...||::|||....|..:.:.|.|||||:.|:::|...||.
  Rat   266 TLIIFTSDNGIPFPSGRTNLYWPGTAEPLLVSSPEHPQRWGQVSDAYVSLLDLTPTILDWFSIPY 330

  Fly   334 PN-------DTKIVGRSILPVLREEPPIKESDSVFGSHSYHEVTMAYPMRMVRNRRYKLIHNINY 391
            |:       ..::.|||:||.|..|||..   :||.|.|:|||||:||||.|.::.::||||:::
  Rat   331 PSYAIFGSKTIQLTGRSLLPALEAEPPWA---TVFSSQSHHEVTMSYPMRSVYHQNFRLIHNLSF 392

  Fly   392 WADFPIDQDFYTSPTFQQILNATLRKQTLPWYRSLLQYYQRPEWELYDIKTDPLERFNLADKAKY 456
            ...||||||||.|||||.:||.|...|...||::|..||.|..||||||..||.|..|||.:..:
  Rat   393 KMPFPIDQDFYVSPTFQDLLNRTAAGQPTGWYKNLQHYYYRERWELYDISRDPRETRNLAAEPDF 457

  Fly   457 NGTLKQLREQLFDWQVATKDPWRCAPHAVLQEQGVYKDQPVCLTLGHE 504
            ...|:.|:.||..||..|.|||.|||..||:|    |..|.|..|.:|
  Rat   458 AQVLEVLKAQLVKWQWETHDPWVCAPDGVLEE----KLTPQCRPLHNE 501

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SgshNP_650760.1 AslA 17..476 CDD:225661 250/465 (54%)
SGSH 22..471 CDD:293751 246/455 (54%)
SgshXP_038943465.1 SGSH 24..472 CDD:293751 245/454 (54%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D194238at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.