DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sgsh and arsd

DIOPT Version :9

Sequence 1:NP_650760.1 Gene:Sgsh / 42266 FlyBaseID:FBgn0038660 Length:524 Species:Drosophila melanogaster
Sequence 2:NP_001015952.1 Gene:arsd / 548706 XenbaseID:XB-GENE-5874310 Length:499 Species:Xenopus tropicalis


Alignment Length:549 Identity:114/549 - (20%)
Similarity:180/549 - (32%) Gaps:188/549 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 KRGLLFNNAF-----TSVSSCSPSRS---QLLTGQAGHSSGMYGL---------------HQGVH 94
            :.|:.|:|.|     .:||:..||..   ..:..|.|:|:|:.|.               |...|
 Frog     8 RSGMDFSNGFRVIVSAAVSAGLPSNETTFATILQQQGYSTGLIGKWHLGLNCASRDDFCHHPNSH 72

  Fly    95 NFNV---LP-------DTGSLP----------NLIRDQSGGRILS----------GIIGKKHVGA 129
            .||.   :|       ..||:|          :.:....|..:|:          .|.||..|..
 Frog    73 GFNYFYGMPFSLYSGCKPGSIPESPNSPKQQLSFVTQIIGFGVLTLTALKYSKILAINGKFLVSC 137

  Fly   130 ANNFRFDFE-----------------QTEEQHSINQIGRNITRMKEYARQFLKQA-----KDEKK 172
            |   .||..                 .....|.|.:...||.|.   ..|.||:|     :::..
 Frog   138 A---VFDLLFFITWYTLYHYAHHWNCMIMRNHEITEQPMNIERS---TSQILKEAHGFIERNKNV 196

  Fly   173 PFFLMVGFHDPHRCGHITPQFGEFCERWGSGEEGMGSIPDWKPIYYDWRNLDVPAWLPDTDVVRQ 237
            ||.|.|.|...|.....|.:|        :|....|:..|                         
 Frog   197 PFLLFVSFLHAHIPLITTKKF--------TGRSNHGTYGD------------------------- 228

  Fly   238 ELAAQYMTISRLDQGVGLMLKELEAAGVADQTLVIYTSDNGPPFP--------GGRTNLY----- 289
                   :|..:|..||.::..::.||:.:.|.:.:|||:|....        ||...:|     
 Frog   229 -------SIEEMDYLVGSVVDAIDTAGLKNNTFIYFTSDHGGHLEAADGNIQLGGWNGIYKGGKA 286

  Fly   290 ----EHGIRSPLI-----ISSPNKEDRHHEATAAMVSLLDIYPSVMDALQIPRPNDTKIVGRSIL 345
                |.|||.|.|     :.|||      .......||:||:|:|:.......|.|..|.||:::
 Frog   287 VAGWEGGIRVPGIFRWPGVISPN------TVCDEPTSLMDIFPTVIQLGGGELPRDRIIDGRNLM 345

  Fly   346 PVLREEPPIKESDSVFGSHSYHEVTMAYPMRMVRNRRYKLIHNINYWADFPIDQDFYTSPTFQ-Q 409
            |:|:::          ..||.||....|....:...|:....:...|      :..:.:|.|. :
 Frog   346 PLLKKQ----------ALHSEHEFLFHYCGSHLHAVRWHEKESGTVW------KAHFITPVFSPE 394

  Fly   410 ILNATLRKQTLPWYRSLLQYYQRPEWELYDIKTDPLER--FNLADKAKYNGTLKQLREQLFDWQV 472
            ........:..|.....:.|:..|  .|:||.|||.|.  ..|..|.:|...:.:::        
 Frog   395 GAGGCYDFKVCPCNGDRVTYHNPP--LLFDISTDPSESSPLQLHLKPQYMQAINRIK-------- 449

  Fly   473 ATKDPWRCAPHAVLQEQGVYKDQPVCLTL 501
                      ||:.:.|......|..|:|
 Frog   450 ----------HAIEEHQRTISPVPQQLSL 468

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SgshNP_650760.1 AslA 17..476 CDD:225661 108/522 (21%)
SGSH 22..471 CDD:293751 108/517 (21%)
arsdNP_001015952.1 ALP_like 1..468 CDD:390042 113/547 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.