DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sgsh and gnsb

DIOPT Version :9

Sequence 1:NP_650760.1 Gene:Sgsh / 42266 FlyBaseID:FBgn0038660 Length:524 Species:Drosophila melanogaster
Sequence 2:NP_956135.2 Gene:gnsb / 327635 ZFINID:ZDB-GENE-030131-5846 Length:507 Species:Danio rerio


Alignment Length:535 Identity:121/535 - (22%)
Similarity:199/535 - (37%) Gaps:141/535 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 NVLLLLADDAGFESGAYLNKFCQTP---NLDALAKRGLLFNNAFTSVSSCSPSRSQLLTGQAGHS 83
            |::|:|.||...:.|.      .||   ..:.:...|..|:|||||...|.||||..|:|:..|:
Zfish    34 NIILILTDDQDEQMGG------MTPMKKTRELIGDAGATFSNAFTSTPLCCPSRSSFLSGRYPHN 92

  Fly    84 SGMYGLHQGVHNFNVLPDTGSLP--------------NLIRDQS--GGRILSGIIGKKHVGAAN- 131
                  |. |||.:|..:..|..              |.:|.|:  .|:.|:....|...|.|: 
Zfish    93 ------HL-VHNNSVEGNCSSAAWQKTAEPFAFPVYLNKMRYQTFYCGKYLNQYGSKDAGGVAHV 150

  Fly   132 -----------------NFRFDFEQTEEQHSINQIGRNITRMKEY--------ARQFLKQAKDEK 171
                             |:.......||:|..:.       .|:|        :..||:: :...
Zfish   151 PPGWDQWHALVGNSKYYNYTLSVNGKEEKHGDSY-------EKDYLTDLVLNRSLHFLEE-RSPS 207

  Fly   172 KPFFLMVGFHDPHRCGHITPQF-GEF----CERWGSGEEGMGSIPDWKPIYYDWRNLDVPA-WLP 230
            .|||:|:....||......||: |.|    ..|.||..: .|:...|.        |..|| .:|
Zfish   208 HPFFMMLCPPAPHSPWTAAPQYSGSFSGVKAPRNGSFNK-PGTDKHWL--------LRQPANPMP 263

  Fly   231 DT--DVVRQELAAQYMTISRLDQGVGLMLKELEAAGVADQTLVIYTSDNGP-----PFPGGRTNL 288
            ::  |.:......::.|:..:|..|..:||:|::....|.|.:.||||:|.     ..|..:..|
Zfish   264 NSSIDYLDNAFRRRWQTLLSVDDLVERLLKKLDSVKELDNTYIFYTSDHGYHTGQFSLPIDKRQL 328

  Fly   289 YEHGIRSPLIISSPNKEDRHHEATAAMVSLLDIYPSVMDALQIPRPNDTKIVGRSILPVLREEPP 353
            ||..||.||::..|..:.:  :...:.|..:|:..:::|...: ..:...:.|:|.||       
Zfish   329 YEFDIRIPLLVRGPGIKAK--QTLQSPVLNIDLPMTILDIAGV-NLSTVNMDGQSFLP------- 383

  Fly   354 IKESDSVFGSHSYHEVTMAYPMRMVRNRRYKLIHNINYWADFPIDQDFYTSPT-----------F 407
                            .||..:|....|.:.|   :.|..:....||    |:           |
Zfish   384 ----------------QMAPSLRNGTERPFFL---VEYTGEGYSSQD----PSCPKLGPGLAECF 425

  Fly   408 QQILNATLRKQTLPWYRSL----LQYYQRPE----WELYDIKTDPLERFNLADKAKYNGTLKQLR 464
            ...:.......|....|:|    |||.:..:    .|:|::..||.:..|:..|.. ...|:.:.
Zfish   426 PDCVCEDAFNNTYACVRTLKGANLQYCEFADNEAFVEMYNLTADPHQLENIVKKVD-PSLLQIMN 489

  Fly   465 EQLFDWQVATKDPWR 479
            ::|...|....|..|
Zfish   490 QRLIKLQSCAGDTCR 504

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SgshNP_650760.1 AslA 17..476 CDD:225661 119/530 (22%)
SGSH 22..471 CDD:293751 118/525 (22%)
gnsbNP_956135.2 AslA 34..496 CDD:225661 118/525 (22%)
G6S 34..480 CDD:293766 115/508 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.