DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sgsh and Arsi

DIOPT Version :9

Sequence 1:NP_650760.1 Gene:Sgsh / 42266 FlyBaseID:FBgn0038660 Length:524 Species:Drosophila melanogaster
Sequence 2:NP_001041346.1 Gene:Arsi / 307404 RGDID:1310242 Length:573 Species:Rattus norvegicus


Alignment Length:546 Identity:117/546 - (21%)
Similarity:194/546 - (35%) Gaps:189/546 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 PQNVLLLLADDAGFESGAYLNKFCQTPNLDALAKRGLLFNNAFTSVSSCSPSRSQLLTGQAGHSS 84
            |.:::.:|.||.|:....|.....:||.||.||..|:...|.:.. ..|:|||||||||:     
  Rat    46 PPHIIFILTDDQGYHDVGYHGSDIETPTLDRLAAEGVKLENYYIQ-PICTPSRSQLLTGR----- 104

  Fly    85 GMYGLHQGV-HNF------NVLP-DTGSLPNLIRDQSGGRILSGIIGKKHV-------------- 127
              |.:|.|: |:.      |.|| |..:||..:::..   ..:.::||.|:              
  Rat   105 --YQIHTGLQHSIIRPRQPNCLPLDQVTLPQKLQEAG---YSTHMVGKWHLGFYRKECLPTRRGF 164

  Fly   128 --------GAANNFRFD---------FEQTE-EQHSINQIGRNITRMKEYARQFLKQAKDEKKPF 174
                    |..:.:.:|         |:..| |..:....|:..|.:.......:..:...:||.
  Rat   165 DTFLGSLTGNVDYYTYDNCDGPGVCGFDLHEGESVAWGLSGQYSTMLYAQRASHILASHSPQKPL 229

  Fly   175 FLMVGFHDPHRCGHITPQFGEFCERWGSGEEGMGSIPDWKPIYYDWRNLDVPAWLPDTDVVRQEL 239
            ||.|.|...|     ||                  :...:...|.:|.:.        :|.|::.
  Rat   230 FLYVAFQAVH-----TP------------------LQSPREYLYRYRTMG--------NVARRKY 263

  Fly   240 AAQYMTISRLDQGVGLMLKELEAAGVADQTLVIYTSDNGP---------PFPGGRTNLYEHGIRS 295
            ||.   ::.:|:.|..:...|:..|..:.:::|::||||.         |..|.:...:|.|:|.
  Rat   264 AAM---VTCMDEAVRNITWALKRYGFYNNSVIIFSSDNGGQTFSGGSNWPLRGRKGTYWEGGVRG 325

  Fly   296 PLIISSP--NKEDRHHEATAAMVSLLDIYP----------SVMDALQIPRPNDTKIVGRSILPVL 348
            ...:.||  .|:.|   .:.|:|.:.|.||          |..|.|.          |..:.|.:
  Rat   326 LGFVHSPLLKKKRR---TSRALVHITDWYPTLVGLAGGTTSAADGLD----------GYDVWPAI 377

  Fly   349 REEPPIKESDSVFGSHSYHEVTMAYPMRMVRNRRYKLIHNI----NYWADFPIDQDFYTSPTFQQ 409
            .|                   ..|.|       |.:::|||    |:.....::..|   ..:..
  Rat   378 SE-------------------GRASP-------RTEILHNIDPLYNHARHGSLEGGF---GIWNT 413

  Fly   410 ILNATLR------------------KQTLP------WYRSLLQYYQRPEWELYDIKTDPLERFNL 450
            .:.|.:|                  .|||.      |....:...::..| |::|..||.||.:|
  Rat   414 AVQAAIRVGEWKLLTGDPGYGDWIPPQTLASFPGSWWNLERMASIRQAVW-LFNISADPYEREDL 477

  Fly   451 ADK------------AKYNGTLKQLR 464
            ||:            |.||.|...:|
  Rat   478 ADQRPDVVRTLLARLADYNRTAIPVR 503

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SgshNP_650760.1 AslA 17..476 CDD:225661 117/546 (21%)
SGSH 22..471 CDD:293751 116/544 (21%)
ArsiNP_001041346.1 4-S 48..478 CDD:293753 108/517 (21%)
AslA 49..485 CDD:225661 111/523 (21%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 506..550
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3119
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.