DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sgsh and Sts

DIOPT Version :9

Sequence 1:NP_650760.1 Gene:Sgsh / 42266 FlyBaseID:FBgn0038660 Length:524 Species:Drosophila melanogaster
Sequence 2:NP_036793.2 Gene:Sts / 24800 RGDID:3783 Length:577 Species:Rattus norvegicus


Alignment Length:626 Identity:137/626 - (21%)
Similarity:212/626 - (33%) Gaps:234/626 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 CSAGP---QNVLLLLADDAGF-ESGAYLNKFCQTPNLDALAKRGLLFNNAFTSVSSCSPSRSQLL 76
            |:|.|   .|.||::|||.|. :.|.|.|:..:||::|.||..|:.......:...|:|||:..|
  Rat    18 CAARPGPGPNFLLIMADDLGIGDLGCYGNRTLRTPHIDRLALEGVKLTQHLAAAPLCTPSRAAFL 82

  Fly    77 TGQAGHSSGM--YGLHQGVHNFNVLPDTGSLP-------NLIRDQSGGRILSGIIGKKHVG---- 128
            ||:....|||  :| ..||..|:.  .:|.||       .|::.|.   ..:|::||.|:|    
  Rat    83 TGRYPVRSGMASHG-RLGVFLFSA--SSGGLPPNEVTFAKLLKGQG---YTTGLVGKWHLGLSCQ 141

  Fly   129 AANNF----------RF------------------------------------------------ 135
            ||::|          ||                                                
  Rat   142 AASDFCHHPGRHGFDRFLGTPTTNLRDCKPGGGTVFGSAQQVFVVLPMNILGAVLLAMALARWAG 206

  Fly   136 ---------------------------------------DFEQTEEQHSINQIGRNITRMKEYAR 161
                                                   ||..|::......:.:   |:...|.
  Rat   207 LARPPGWVFGVTVAAMAAVGGAYVAFLYHFRPANCFLMADFTITQQPTDYKGLTQ---RLASEAG 268

  Fly   162 QFLKQAKDEKKPFFLMVGFHDPHRCGHITPQFGEFCERWGSGEEGMGSIPDWKPIYYDWRNLDVP 226
            .||::.:|  .||.|.:.|...|......|:|        :|:...|:..|              
  Rat   269 DFLRRNRD--TPFLLFLSFMHVHTAHFANPEF--------AGQSLHGAYGD-------------- 309

  Fly   227 AWLPDTDVVRQELAAQYMTISRLDQGVGLMLKELEAAGVADQTLVIYTSDNGPP----------- 280
                              .:..:|..||.:|..|:..|:|:.|||.:|||:|..           
  Rat   310 ------------------AVEEMDWAVGQVLATLDKLGLANNTLVYFTSDHGAHVEELGPNGERH 356

  Fly   281 ------FPGGRTNLYEHGIRSPLIISSPN---KEDRHHEATAAMVSLLDIYPSVMDALQIPRPND 336
                  :.||:.|.:|.|||.|.::..|.   ......|.|:.|    |::|:|........|.|
  Rat   357 GGSNGIYRGGKANTWEGGIRVPGLVRWPGVIVPGQEVEEPTSNM----DVFPTVARLAGAELPTD 417

  Fly   337 TKIVGRSILPVLREEPPIKESDSVFG--SHSYHEVTMAYPMRMVRNRRYKLIHNINYWADFPIDQ 399
            ..|.||.::|:|            .|  .||.||....|....:...|::..::.:.|      :
  Rat   418 RVIDGRDLMPLL------------LGHVQHSEHEFLFHYCNAYLSAVRWRPHNSSSVW------K 464

  Fly   400 DFYTSPTFQQI-LNATLRKQTLPWYRSLLQYYQRPEWELYDIKTDPLERFNLADKAK-------- 455
            .||.:|.|... .|..........:...:.::..|  .|:||..||.||..|..:.:        
  Rat   465 AFYFTPNFDPPGSNGCFSTHVCMCHGHHVTHHDPP--LLFDIARDPRERHPLTPETEPRHGEILR 527

  Fly   456 --------YNGTLKQLREQLFDWQVATKDPWR---CA--PH 483
                    :..||::...||....||.| ||.   ||  ||
  Rat   528 NMDAAARAHVATLEEAPNQLSMSNVAWK-PWLQLCCASKPH 567

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SgshNP_650760.1 AslA 17..476 CDD:225661 129/611 (21%)
SGSH 22..471 CDD:293751 125/598 (21%)
StsNP_036793.2 ALP_like 26..548 CDD:419962 124/596 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.