DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment EndoA and AT4G34660

DIOPT Version :9

Sequence 1:NP_001262717.1 Gene:EndoA / 42265 FlyBaseID:FBgn0038659 Length:369 Species:Drosophila melanogaster
Sequence 2:NP_567969.1 Gene:AT4G34660 / 829618 AraportID:AT4G34660 Length:368 Species:Arabidopsis thaliana


Alignment Length:400 Identity:75/400 - (18%)
Similarity:141/400 - (35%) Gaps:101/400 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LKKQINKANQYMTEKM-GGAEGTKLDMDFMEMERKTDVTVELVEELQLKTKEFLQPNPTARAKMA 69
            |::|:.:..|.:.::. ||..|:.| .|..|:.:.     :.:|:|.:.|:      .....:..
plant    11 LREQVARQQQAVFKQFGGGGYGSGL-ADEAELNQH-----QKLEKLYISTR------AAKHYQRD 63

  Fly    70 AVKGISKLSGQAKSNTYPQPEGLL--AECMLTYGKKLGEDN------------SVFAQALVEFGE 120
            .|:|:               ||.:  ....:..|.||.||:            :|..:|.:.:|.
plant    64 IVRGV---------------EGYIVTGSKQVEIGTKLSEDSRKYGSENTCTNGNVLTRAALNYGR 113

  Fly   121 ALKQMADVKYSLDDNIKQNFLEPLHHMQT-KDLKEVMHHRKKLQGRRLDFDCK----RRRQAKDD 180
            |..||...:.::...:.....|||..|.. ..|::..|..::....|.:.:.:    .|||||..
plant   114 ARAQMEKERGNMLKALGTQVAEPLRAMVLGAPLEDARHLAQRYDRMRQEAEAQATEVARRQAKAR 178

  Fly   181 EIRGAEDKFGESLQLAQVGMFNLLENDT----EHVS---------------QLVTFAEALYDFHS 226
            |.:|..|.. ..|:.|:..:.:|..|.|    |..|               :|::..|:...:|.
plant   179 ESQGNPDIL-MKLESAEAKLHDLKSNMTILGKEAASALASVEDQQQKLTLERLLSMVESERAYHQ 242

  Fly   227 QCADVLRGLQETLQEKRSEAESRPRNEFVPKTLLDLNLDGGGGGLNEDGTPSHISSSASPLPSPM 291
            :...:|..|:..:..:|...|:                            ||..||:.|..|.|.
plant   243 RVLQILDQLEGEMVSERQRIEA----------------------------PSTPSSADSMPPPPS 279

  Fly   292 RSPAKSMAVTPQRQQQP------CCQALYDFEPENPGELAFKENDIITLLNRVDDNWFEGAVNGR 350
            ...|..:..:.......      ..:.|:.:......||:....:.:.:.......|.||...|:
plant   280 YEEANGVFASQMHDTSTDSMGYFLGEVLFPYHGVTDVELSLSTGEYVVVRKVTGSGWAEGECKGK 344

  Fly   351 TGYFPQSYVQ 360
            .|:||..|::
plant   345 AGWFPYGYIE 354

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
EndoANP_001262717.1 BAR_Endophilin_A 25..246 CDD:153276 50/258 (19%)
SH3_Endophilin_A 312..361 CDD:212737 11/48 (23%)
AT4G34660NP_567969.1 BAR_SH3P_plant 45..254 CDD:153291 45/230 (20%)
SH3 303..354 CDD:418401 11/50 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 48 1.000 Inparanoid score I2650
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D788657at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR14167
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.070

Return to query results.
Submit another query.