DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment EndoA and grb2

DIOPT Version :9

Sequence 1:NP_001262717.1 Gene:EndoA / 42265 FlyBaseID:FBgn0038659 Length:369 Species:Drosophila melanogaster
Sequence 2:NP_001008130.1 Gene:grb2 / 493492 XenbaseID:XB-GENE-6070000 Length:229 Species:Xenopus tropicalis


Alignment Length:227 Identity:52/227 - (22%)
Similarity:79/227 - (34%) Gaps:92/227 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly   218 AEALYDFHSQC--------ADVLRGLQETLQEKRSEAESRPRNEFVPKTLLDLN----------- 263
            |.|.|||.:..        .|:|:.|.|...:...:||...::.|:||..:::.           
 Frog     3 AVAKYDFKATADDELSFKRGDILKVLNEECDQNWYKAELNGKDGFIPKNYIEMKPHPWFFGKIPR 67

  Fly   264 --------------------------------------------LDGGG---------GGLNEDG 275
                                                        .||.|         ..||| .
 Frog    68 AKAEEMLGKQRHDGAFLIRESESAPGDFSLSVKFGNDVQHFKVLRDGAGKYFLWVVKFNSLNE-L 131

  Fly   276 TPSHISSSASPLPSPMRSP---AKSMAVTPQ----------RQQQPCCQALYDFEPENPGELAFK 327
            ...|.|:|.|      |:.   .:.:...||          .||....|||:||:|:..|||.|:
 Frog   132 VDYHRSTSVS------RNQQIFLRDIEQVPQVHGGDRATNLLQQPTYVQALFDFDPQEDGELGFR 190

  Fly   328 ENDIITLLNRVDDNWFEGAVNGRTGYFPQSYV 359
            ..|.|.:::..|.||::|...|:||.||::||
 Frog   191 RGDFIQVVDNSDPNWWKGTCLGQTGMFPRNYV 222

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
EndoANP_001262717.1 BAR_Endophilin_A 25..246 CDD:153276 9/35 (26%)
SH3_Endophilin_A 312..361 CDD:212737 22/48 (46%)
grb2NP_001008130.1 SH3_GRB2_N 1..56 CDD:212879 14/52 (27%)
SH2_Grb2_like 56..150 CDD:199828 11/100 (11%)
SH3_GRB2_C 172..224 CDD:212882 23/51 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R571
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.030

Return to query results.
Submit another query.