DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment EndoA and stam2

DIOPT Version :9

Sequence 1:NP_001262717.1 Gene:EndoA / 42265 FlyBaseID:FBgn0038659 Length:369 Species:Drosophila melanogaster
Sequence 2:NP_001007370.2 Gene:stam2 / 492497 ZFINID:ZDB-GENE-041114-64 Length:509 Species:Danio rerio


Alignment Length:171 Identity:43/171 - (25%)
Similarity:68/171 - (39%) Gaps:35/171 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   223 DFHSQCADVLRGLQETLQEKRSEAESRPRNEFVPKTLLDLNLDGGGGGLNEDG----TPSHISSS 283
            :|.|:...||......:.||.....:....:|.....|.| :......|.|:|    |.:..|||
Zfish    88 EFASEVRGVLNRAHPKVNEKLKALMAEWAEDFQKDPQLSL-IGATIKSLKEEGVTFPTANPQSSS 151

  Fly   284 ASPLPSPMRSP-------AKSMAVTPQRQQQPC-----------------------CQALYDFEP 318
            ..|..:|..|.       ||::.::.|.|:|..                       .:||||||.
Zfish   152 TKPSSTPATSRASADDDLAKAIELSLQEQKQQTETRPLTVIADPPYNTNGGKESRKVRALYDFEA 216

  Fly   319 ENPGELAFKENDIITLLNRVDDNWFEGAVNGRTGYFPQSYV 359
            ....||.||..:::.:|:..|.||::|..:...|.||.::|
Zfish   217 AEDNELTFKAGELVIILDDSDPNWWKGENHRGVGLFPSNFV 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
EndoANP_001262717.1 BAR_Endophilin_A 25..246 CDD:153276 6/22 (27%)
SH3_Endophilin_A 312..361 CDD:212737 19/48 (40%)
stam2NP_001007370.2 VHS_STAM 9..147 CDD:239625 13/59 (22%)
SH3_STAM 206..259 CDD:212754 19/52 (37%)
GAT 295..368 CDD:281166
Forkhead_N 366..479 CDD:254796
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R571
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.030

Return to query results.
Submit another query.