DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment EndoA and Dlish

DIOPT Version :9

Sequence 1:NP_001262717.1 Gene:EndoA / 42265 FlyBaseID:FBgn0038659 Length:369 Species:Drosophila melanogaster
Sequence 2:NP_611251.2 Gene:Dlish / 37014 FlyBaseID:FBgn0034264 Length:355 Species:Drosophila melanogaster


Alignment Length:225 Identity:53/225 - (23%)
Similarity:86/225 - (38%) Gaps:51/225 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   146 HMQTKDLKEVMHHRKKLQGRRLDFDCKRRRQAKDDEIRGAEDKFGESLQLAQVGMFNLL--ENDT 208
            |..:.|.|.|:.|         ||     ....|||:   |.|.|:        :.|:|  |||.
  Fly    54 HGLSPDSKMVVLH---------DF-----TPCVDDEL---EVKRGQ--------LVNILYRENDW 93

  Fly   209 EHVSQLVTFAEALYDFHSQCADVLRGLQETLQEK---RSEAESRPRNEFVPKTLLDLNLDGGGGG 270
            .:|....:..|....| |.||.....|.:...:|   |.:...:|..|.:|....|..||     
  Fly    94 VYVIGQDSRQEGFIPF-SYCAPCNTQLADLAVKKKLPREQCPEQPIEENIPLLGTDNKLD----- 152

  Fly   271 LNEDGTPSHISSSASPLPSPMRSPAKSMAVTPQ-----RQQQPCCQALYDFEPENPGELAFKEND 330
                     :....:..|....|...::.|.|:     ::....|..||.|...:..:|:.:..:
  Fly   153 ---------VLCDETLNPGSANSIENTLLVEPECTPFVKEPSGRCIVLYTFIARDENDLSVERGE 208

  Fly   331 IITLLNRVDDNWF-EGAVNGRTGYFPQSYV 359
            .:|:|||.|.:|| ....:|:.|:.|.|::
  Fly   209 FVTVLNREDPDWFWIMRSDGQEGFVPASFI 238

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
EndoANP_001262717.1 BAR_Endophilin_A 25..246 CDD:153276 27/104 (26%)
SH3_Endophilin_A 312..361 CDD:212737 15/49 (31%)
DlishNP_611251.2 SH3 61..111 CDD:212690 19/75 (25%)
SH3 184..238 CDD:214620 16/53 (30%)
SH3 293..346 CDD:212690
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45453118
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.