DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment EndoA and POSH

DIOPT Version :9

Sequence 1:NP_001262717.1 Gene:EndoA / 42265 FlyBaseID:FBgn0038659 Length:369 Species:Drosophila melanogaster
Sequence 2:NP_523776.1 Gene:POSH / 36990 FlyBaseID:FBgn0040294 Length:838 Species:Drosophila melanogaster


Alignment Length:186 Identity:51/186 - (27%)
Similarity:81/186 - (43%) Gaps:35/186 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   211 VSQLVTFAEALYDFHSQCADVLRGLQETLQEKR---------SEAESRPRNEFVPKTLLDLNLDG 266
            :.:|.|.::.|...|:.|...|:.:..:..:.|         .:.:..|.|..:.:.|..:..:.
  Fly    16 LERLDTTSKVLPCQHTFCRKCLQDIVASQHKLRCPECRILVSCKIDELPPNVLLMRILEGMKQNA 80

  Fly   267 GGGGLNEDGTPSHIS-SSASPLPSPMRSPAKSMAV---------------TPQRQQQ-----PCC 310
            ..|...|.|..:... ..|.|.|     ||:|:|.               .|.|.:|     |..
  Fly    81 AAGKGEEKGEETETQPERAKPQP-----PAESVAPPDNQLLQLQSHQQSHQPARHKQRRFLLPHA 140

  Fly   311 QALYDFEPENPGELAFKENDIITLLNRVDDNWFEGAVNGRTGYFPQSYVQVQVPLP 366
            .||:||......:|.||:.|:|.:.:|:|:|||.|..||:.|.||.:||:|.||||
  Fly   141 YALFDFASGEATDLKFKKGDLILIKHRIDNNWFVGQANGQEGTFPINYVKVSVPLP 196

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
EndoANP_001262717.1 BAR_Endophilin_A 25..246 CDD:153276 7/43 (16%)
SH3_Endophilin_A 312..361 CDD:212737 22/48 (46%)
POSHNP_523776.1 RING 11..53 CDD:238093 7/36 (19%)
SH3 139..191 CDD:302595 22/51 (43%)
SH3_SH3RF_2 199..251 CDD:212721
SH3_SH3RF_3 424..477 CDD:212717
SH3_SH3RF_C 782..836 CDD:212719
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45453120
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR14167
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.