powered by:
Protein Alignment EndoA and drk
DIOPT Version :9
Sequence 1: | NP_001262717.1 |
Gene: | EndoA / 42265 |
FlyBaseID: | FBgn0038659 |
Length: | 369 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_476858.1 |
Gene: | drk / 36497 |
FlyBaseID: | FBgn0004638 |
Length: | 211 |
Species: | Drosophila melanogaster |
Alignment Length: | 49 |
Identity: | 25/49 - (51%) |
Similarity: | 34/49 - (69%) |
Gaps: | 0/49 - (0%) |
- Green bases have known domain annotations that are detailed below.
Fly 311 QALYDFEPENPGELAFKENDIITLLNRVDDNWFEGAVNGRTGYFPQSYV 359
||||||.|:..|||.|:..|:||:.:|.|:||:.|.:..|.|.||.:||
Fly 158 QALYDFVPQESGELDFRRGDVITVTDRSDENWWNGEIGNRKGIFPATYV 206
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
1 |
1.000 |
60 |
1.000 |
Domainoid score |
I2555 |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
1 |
1.030 |
- |
avgDist |
Average_Evolutionary_Distance |
R571 |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
|
2 | 2.030 |
|
Return to query results.
Submit another query.