DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment EndoA and Stam

DIOPT Version :9

Sequence 1:NP_001262717.1 Gene:EndoA / 42265 FlyBaseID:FBgn0038659 Length:369 Species:Drosophila melanogaster
Sequence 2:NP_477448.1 Gene:Stam / 34505 FlyBaseID:FBgn0027363 Length:689 Species:Drosophila melanogaster


Alignment Length:295 Identity:72/295 - (24%)
Similarity:117/295 - (39%) Gaps:61/295 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    82 KSNTYPQPEGLLAECMLTYGKKLGE-DNSVFAQALVEFGEALKQMADVKYSLDDNIKQNFLEPLH 145
            |..|.|:   |..:|:....:::|. |..|..||:               :|.|.:..|..:|||
  Fly    36 KVTTNPR---LAKDCLKAVMRRMGHTDPHVVMQAI---------------TLLDALSNNCGKPLH 82

  Fly   146 HMQTKDLKEVMHHRKKLQGRRLDFDCK-RRRQAKDDEIRGAEDKFGESLQLAQVGMFNLLENDTE 209
                            |:....||:.: ||..||      |:.|.  ||::.|| :.|..|||.:
  Fly    83 ----------------LEVASRDFETEFRRLLAK------AQPKV--SLKMRQV-LKNWAENDYK 122

  Fly   210 HVSQL-------VTFAEALYDFHSQCADVLRGLQE---TLQEKRSEAESRPRNEFVPKTLLDLNL 264
            :..:|       ....:..|||.:......:.:.|   .|.:..:...|:...:.:.|. ::|:|
  Fly   123 NDRELDLIPALYAKLRQEGYDFKNLGDKTSKTVAEKAAALPKDPNVVSSQQEEDDIAKA-IELSL 186

  Fly   265 DGGGGGLNEDGTPSHISSSASPLPSPMRSPAKSMAVTPQRQQQPC-----CQALYDFEPENPGEL 324
            ....|........|..::||.|...|..:...|.|.:.:....|.     .:||||||.....||
  Fly   187 KENKGSPKTGSVASTGTASAYPSLYPSFAGTGSSAPSAEASSAPAPEPRKVRALYDFEAAEENEL 251

  Fly   325 AFKENDIITLLNRVDDNWFEGAVNGRTGYFPQSYV 359
            .|...:||.:|:..|.||::|......|.||.::|
  Fly   252 TFFAGEIIHVLDDSDPNWWKGYNQRGEGLFPSNFV 286

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
EndoANP_001262717.1 BAR_Endophilin_A 25..246 CDD:153276 39/175 (22%)
SH3_Endophilin_A 312..361 CDD:212737 20/48 (42%)
StamNP_477448.1 VHS_STAM 10..154 CDD:239625 37/160 (23%)
SH3_STAM 235..288 CDD:212754 20/52 (38%)
GAT 340..412 CDD:281166
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R571
SonicParanoid 00.000 Not matched by this tool.
11.030

Return to query results.
Submit another query.