Sequence 1: | NP_001262717.1 | Gene: | EndoA / 42265 | FlyBaseID: | FBgn0038659 | Length: | 369 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_002077.1 | Gene: | GRB2 / 2885 | HGNCID: | 4566 | Length: | 217 | Species: | Homo sapiens |
Alignment Length: | 215 | Identity: | 53/215 - (24%) |
---|---|---|---|
Similarity: | 80/215 - (37%) | Gaps: | 80/215 - (37%) |
- Green bases have known domain annotations that are detailed below.
Fly 218 AEALYDFHSQC--------ADVLRGLQETLQEKRSEAESRPRNEFVPKTLLDLN----------- 263
Fly 264 --------------------------------------------LDGGG---------GGLNEDG 275
Fly 276 TPSHISSSASPLPSPMRSPAKSMAVTPQRQQQPC-CQALYDFEPENPGELAFKENDIITLLNRVD 339
Fly 340 DNWFEGAVNGRTGYFPQSYV 359 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
EndoA | NP_001262717.1 | BAR_Endophilin_A | 25..246 | CDD:153276 | 9/35 (26%) |
SH3_Endophilin_A | 312..361 | CDD:212737 | 23/48 (48%) | ||
GRB2 | NP_002077.1 | SH3_GRB2_N | 1..56 | CDD:212879 | 14/52 (27%) |
SH2_Grb2_like | 56..150 | CDD:199828 | 11/100 (11%) | ||
SH3_GRB2_C | 160..212 | CDD:212882 | 24/51 (47%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 1 | 1.030 | - | avgDist | Average_Evolutionary_Distance | R571 |
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 1 | 1.000 | - | - | ||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
2 | 2.030 |