DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment EndoA and GRB2

DIOPT Version :9

Sequence 1:NP_001262717.1 Gene:EndoA / 42265 FlyBaseID:FBgn0038659 Length:369 Species:Drosophila melanogaster
Sequence 2:NP_002077.1 Gene:GRB2 / 2885 HGNCID:4566 Length:217 Species:Homo sapiens


Alignment Length:215 Identity:53/215 - (24%)
Similarity:80/215 - (37%) Gaps:80/215 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly   218 AEALYDFHSQC--------ADVLRGLQETLQEKRSEAESRPRNEFVPKTLLDLN----------- 263
            |.|.|||.:..        .|:|:.|.|...:...:||...::.|:||..:::.           
Human     3 AIAKYDFKATADDELSFKRGDILKVLNEECDQNWYKAELNGKDGFIPKNYIEMKPHPWFFGKIPR 67

  Fly   264 --------------------------------------------LDGGG---------GGLNEDG 275
                                                        .||.|         ..||| .
Human    68 AKAEEMLSKQRHDGAFLIRESESAPGDFSLSVKFGNDVQHFKVLRDGAGKYFLWVVKFNSLNE-L 131

  Fly   276 TPSHISSSASPLPSPMRSPAKSMAVTPQRQQQPC-CQALYDFEPENPGELAFKENDIITLLNRVD 339
            ...|.|:|.|      |:....:....|..|||. .|||:||:|:..|||.|:..|.|.:::..|
Human   132 VDYHRSTSVS------RNQQIFLRDIEQVPQQPTYVQALFDFDPQEDGELGFRRGDFIHVMDNSD 190

  Fly   340 DNWFEGAVNGRTGYFPQSYV 359
            .||::||.:|:||.||::||
Human   191 PNWWKGACHGQTGMFPRNYV 210

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
EndoANP_001262717.1 BAR_Endophilin_A 25..246 CDD:153276 9/35 (26%)
SH3_Endophilin_A 312..361 CDD:212737 23/48 (48%)
GRB2NP_002077.1 SH3_GRB2_N 1..56 CDD:212879 14/52 (27%)
SH2_Grb2_like 56..150 CDD:199828 11/100 (11%)
SH3_GRB2_C 160..212 CDD:212882 24/51 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R571
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.