DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment EndoA and hse1

DIOPT Version :9

Sequence 1:NP_001262717.1 Gene:EndoA / 42265 FlyBaseID:FBgn0038659 Length:369 Species:Drosophila melanogaster
Sequence 2:NP_595425.1 Gene:hse1 / 2540055 PomBaseID:SPBC1734.08 Length:373 Species:Schizosaccharomyces pombe


Alignment Length:129 Identity:40/129 - (31%)
Similarity:62/129 - (48%) Gaps:4/129 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly   232 LRGLQETLQEKRSEAESRPRNEFVPKTLLDLNLDGGGGGLNEDGTPSHISSSASPLPSPMRSPAK 296
            ||..::..:|..:|.|.: |.|...:..|.|:|.......|:...|.  |:...||....:....
pombe   146 LRAPKKPEKEAMNELELK-REEEELQYALALSLSESTAQSNKVENPQ--STKDEPLQKTNQRQES 207

  Fly   297 SMAVTPQRQQQPCCQALYDFEPENPGELAFKENDIITLLNRVDDNWFEGAVNGRTGYFPQSYVQ 360
            ::|.:|...... .:|||||.....|||:||:.|||.:|..|..:|::|:.....|.||.:|||
pombe   208 NLATSPASTVSR-VRALYDFAATEQGELSFKKGDIILVLESVYKDWWKGSCKNAVGIFPVNYVQ 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
EndoANP_001262717.1 BAR_Endophilin_A 25..246 CDD:153276 3/13 (23%)
SH3_Endophilin_A 312..361 CDD:212737 23/49 (47%)
hse1NP_595425.1 VHS 9..140 CDD:197630
SH3_GRB2_like_C 219..271 CDD:212739 23/53 (43%)
GAT 297..362 CDD:281166
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R571
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.030

Return to query results.
Submit another query.