DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment EndoA and SPBC119.05c

DIOPT Version :9

Sequence 1:NP_001262717.1 Gene:EndoA / 42265 FlyBaseID:FBgn0038659 Length:369 Species:Drosophila melanogaster
Sequence 2:NP_595286.1 Gene:SPBC119.05c / 2539945 PomBaseID:SPBC119.05c Length:296 Species:Schizosaccharomyces pombe


Alignment Length:149 Identity:39/149 - (26%)
Similarity:66/149 - (44%) Gaps:25/149 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   239 LQEKRSEAESRPRNEFVPKTLLDLNLDGGGGGLNED-----GTP--------SHISSSASPLPSP 290
            |.:::|..|.|..:.......:.|:.:.|.....|:     |.|        |.::||...||.|
pombe    65 LPKRKSSVEKRAGSVASAVAAMSLSQNSGEKRTPEEPRKLPGVPAPQKQSEASSVNSSTEKLPPP 129

  Fly   291 MRSPAKSMAVTPQRQQQPCCQALYDFEPENPGELAFKENDIITLLNRVDDNWFEGAVNGRTGYFP 355
            ...|..:.|    .:......|:|||...:.|:|.|...::|.:|..|:::|:.|.:||:.|.||
pombe   130 PSYPGPNTA----HKNVERVLAMYDFPGPDAGDLGFHAGEVIIVLEHVNNDWWRGELNGKEGIFP 190

  Fly   356 QSYVQV--------QVPLP 366
            .:||::        |.|.|
pombe   191 SNYVRLLEDSAVKAQPPPP 209

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
EndoANP_001262717.1 BAR_Endophilin_A 25..246 CDD:153276 2/6 (33%)
SH3_Endophilin_A 312..361 CDD:212737 19/48 (40%)
SPBC119.05cNP_595286.1 SH3 142..195 CDD:214620 18/52 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000985
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR14167
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.100

Return to query results.
Submit another query.