DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment EndoA and Stam

DIOPT Version :9

Sequence 1:NP_001262717.1 Gene:EndoA / 42265 FlyBaseID:FBgn0038659 Length:369 Species:Drosophila melanogaster
Sequence 2:NP_035614.1 Gene:Stam / 20844 MGIID:1329014 Length:548 Species:Mus musculus


Alignment Length:279 Identity:57/279 - (20%)
Similarity:111/279 - (39%) Gaps:53/279 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    82 KSNTYPQPEGLLAECMLTYGKKLG-EDNSVFAQALVEFGEALKQMADVKYSLDDNIKQNFLEPLH 145
            :|.|.|:      :|:.:..:::. :|..|..|||...|..:.....:.:.  :...::|...:.
Mouse    38 QSRTGPK------DCLRSIMRRVNHKDPHVAMQALTLLGACVSNCGKIFHL--EVCSRDFASEVS 94

  Fly   146 HMQTKDLKEVMHHRKKLQGRRLDFDCKRRRQAKDDEIRGAEDKFGESLQLAQVGMFNLLENDTEH 210
            ::..|...:|.   :||:...:::                .|:|....||:.:..  :::|..| 
Mouse    95 NVLNKGHPKVC---EKLKALMVEW----------------TDEFKNDPQLSLISA--MIKNLKE- 137

  Fly   211 VSQLVTFAEALYDFHSQCADVLRGLQETLQEKRSEAESRPRNEFVPKTLLDLNLDGGGGGLNEDG 275
              |.|||..    ..||.|:..:.....:.:......::...|.:.|. ::|:|.          
Mouse   138 --QGVTFPA----IGSQAAEQAKASPALVAKDPGTVATKKEEEDLAKA-IELSLK---------- 185

  Fly   276 TPSHISSSASPLPSPMRSPAKSMAVTPQRQQQPCCQALYDFEPENPGELAFKENDIITLLNRVDD 340
                 .......|.....|:.|..:|..:.:....:|:||||.....||.||..:|||:|:..|.
Mouse   186 -----EQRQQSAPVSTLYPSTSNLLTNHQHEGRKVRAVYDFEAAEDNELTFKAGEIITVLDDSDP 245

  Fly   341 NWFEGAVNGRTGYFPQSYV 359
            ||::|..:...|.||.::|
Mouse   246 NWWKGETHQGVGLFPSNFV 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
EndoANP_001262717.1 BAR_Endophilin_A 25..246 CDD:153276 28/164 (17%)
SH3_Endophilin_A 312..361 CDD:212737 21/48 (44%)
StamNP_035614.1 VHS_STAM 9..142 CDD:239625 23/135 (17%)
SH3_STAM1 213..267 CDD:212897 21/52 (40%)
GAT 306..377 CDD:281166
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 436..458
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 517..548
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R571
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.030

Return to query results.
Submit another query.