powered by:
Protein Alignment EndoA and sem-5
DIOPT Version :9
Sequence 1: | NP_001262717.1 |
Gene: | EndoA / 42265 |
FlyBaseID: | FBgn0038659 |
Length: | 369 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_509342.1 |
Gene: | sem-5 / 181055 |
WormBaseID: | WBGene00004774 |
Length: | 228 |
Species: | Caenorhabditis elegans |
Alignment Length: | 49 |
Identity: | 29/49 - (59%) |
Similarity: | 37/49 - (75%) |
Gaps: | 0/49 - (0%) |
- Green bases have known domain annotations that are detailed below.
Fly 311 QALYDFEPENPGELAFKENDIITLLNRVDDNWFEGAVNGRTGYFPQSYV 359
|||:||.|:..||||||..|:|||:|:.|.||:||.:|.|.|.||.:||
Worm 160 QALFDFNPQESGELAFKRGDVITLINKDDPNWWEGQLNNRRGIFPSNYV 208
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
1 |
1.030 |
- |
avgDist |
Average_Evolutionary_Distance |
R571 |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
1 |
1.000 |
- |
- |
|
|
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
2 | 2.030 |
|
Return to query results.
Submit another query.